Received: by 2002:a25:ad19:0:0:0:0:0 with SMTP id y25csp1618781ybi; Wed, 17 Jul 2019 18:52:24 -0700 (PDT) X-Google-Smtp-Source: APXvYqyN/nUi/inqXxi+VU8wbRyFG8CwsHA7GRsbTduC8qC7FkdKRMqIuQApjJF3Rpv+wwKiAzVI X-Received: by 2002:a17:902:aa41:: with SMTP id c1mr46654962plr.201.1563414744595; Wed, 17 Jul 2019 18:52:24 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1563414744; cv=none; d=google.com; s=arc-20160816; b=sSoHNXZsZ4b5CJsXyHM7kVSH9hZ4vx7P0I2RMkZHgNwnwHjp/fS55mPvHtWfVXWAbA jgf4vQ3QKrbWMAbhjtBT52yR0gAWQ2/PUP6YCnUWokkKmF6fObBkCJkC2AmIEQn2Tv7B 3E5Gnmv4lbVA375ccYMK0tvnjSJMYtuYI9j12zt43c+AqzmasKt61zCqLOkMYz89fTI7 tj/+7zkQZf0YfEnvMgBaZSvEI0zUtJtRaSeEyjEb6CDbEP1BjZS8j8j0JuP8UhzM8I2X byvT099bahWwMen3bdvFUldcF6ucVQPVjNw8WEfMs68PlpVNDQL8UKpURBSprvSWU/Nw ARgA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:sender:subject:cc:to:from:date:references :in-reply-to:message-id:mime-version:user-agent:dkim-signature :dkim-signature; bh=9Rjxs3ybdXD97njl51L/lenQ/wepI2jgkiQSvZwds3s=; b=wkCrtZD4K3xIkX0cSmbTV4jw3HW/yeP5oWg6mpsilPbtgMSUcSycMDkXI3Z3yUKhgv D66ac3Vkmg2Md+zEJrkqd1kAu7tghNYWzBxhJBzW77ZW1+JAfcVNbBUpaQcBJngvefzo XK3UJR7wmWGNNmEIkadU7tniFCpfudaM2br2IFHoMul5H6fKQ39p0b0nLnbS07moAaGZ Dq7cp6AeUZUi8IOPizaWRVLjnS6yAv1nzZZVJud/8W1CkiZARjlwOsWdAdj1TRElYBJv Yngf4mSn2vjV4CPqPgNpUwEWkej5pEpoMW0FA+5SFn/i3tlJXN2sL4c1nxKhTizkA3mv 1i/Q== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@aj.id.au header.s=fm3 header.b="Xcm/YHBy"; dkim=pass header.i=@messagingengine.com header.s=fm3 header.b=lMuDHEXf; spf=pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from vger.kernel.org (vger.kernel.org. [209.132.180.67]) by mx.google.com with ESMTP id n1si25173070pgi.380.2019.07.17.18.52.08; Wed, 17 Jul 2019 18:52:24 -0700 (PDT) Received-SPF: pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) client-ip=209.132.180.67; Authentication-Results: mx.google.com; dkim=pass header.i=@aj.id.au header.s=fm3 header.b="Xcm/YHBy"; dkim=pass header.i=@messagingengine.com header.s=fm3 header.b=lMuDHEXf; spf=pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S2387715AbfGRBtc (ORCPT + 99 others); Wed, 17 Jul 2019 21:49:32 -0400 Received: from new1-smtp.messagingengine.com ([66.111.4.221]:48613 "EHLO new1-smtp.messagingengine.com" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S1729988AbfGRBtb (ORCPT ); Wed, 17 Jul 2019 21:49:31 -0400 Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailnew.nyi.internal (Postfix) with ESMTP id 7A770260F; Wed, 17 Jul 2019 21:49:30 -0400 (EDT) Received: from imap2 ([10.202.2.52]) by compute4.internal (MEProxy); Wed, 17 Jul 2019 21:49:30 -0400 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=aj.id.au; h= mime-version:message-id:in-reply-to:references:date:from:to:cc :subject:content-type; s=fm3; bh=9Rjxs3ybdXD97njl51L/lenQ/wepI2j gkiQSvZwds3s=; b=Xcm/YHByppopAK35/zTpmNQeD96EbG8sbIV0aGGuJtzigLD VLcegeMSPa+8DzFZPjCBAMGIFNvtwWlb4CXm0Yyvg2DIAIiH7904aT3AkzzVltzU c/zjd0f8Busrit7edtg+Mu28pgq9BREB/m9zjMK955r32M8SX0tpArywQM4DVwzr H0OsvbOkLCaTjkOzu5m+Tjp+9Tj7GWiyj2gnusUg+sTDs+UBhzYmKTK7zTfGXMqf zly0Ch0mGKoeCi3ZB7iePQjzSPWluh6R1+HBOqvpWWpBhxPFar7B5WZIgPIJrOzA Z0Bpi60BpvOJPIZOpOE6ox+DJZs2eHnJDOqwYRQ== DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d= messagingengine.com; h=cc:content-type:date:from:in-reply-to :message-id:mime-version:references:subject:to:x-me-proxy :x-me-proxy:x-me-sender:x-me-sender:x-sasl-enc; s=fm3; bh=9Rjxs3 ybdXD97njl51L/lenQ/wepI2jgkiQSvZwds3s=; b=lMuDHEXfjp6pWBOr7n9F+W Vtm0pSIKcPfRgRonhx+Llt/HU/pUcNTPXYy6/DqFq/llMh4/VFsDLQ27qt1yuoSn Pyqs65Vo/H9B8N9FY+kGWRBs1FcVvDBs3drQlLBMwbn9UE4xzPT1svrzMRh0qVwc mIHuJGG3k0CpfW9SFnU9EAEZKKkr7C73bDuP6SmFS+pOjR/XmEgPTT26SfmdZeXO opyeNY9VP/gianUENE5oUg8S4SI9Lz0JUDMru2GliYEGcFK0sAxMeT8LGTTgJY0C 7bqhLDwAmL02S8J9/JJmKMo9NH6putOw/ehaO/b5GKdDihPuIOiWMTvqNvSiTD0Q == X-ME-Sender: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgeduvddrieeggdeglecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpefofgggkfgjfhffhffvufgtsehttdertderredtnecuhfhrohhmpedftehnughr vgifucflvghffhgvrhihfdcuoegrnhgurhgvfiesrghjrdhiugdrrghuqeenucffohhmrg hinhepuggvvhhitggvthhrvggvrdhorhhgpdifrhhithhinhhgqdhstghhvghmrgdrmhgu necurfgrrhgrmhepmhgrihhlfhhrohhmpegrnhgurhgvfiesrghjrdhiugdrrghunecuve hluhhsthgvrhfuihiivgeptd X-ME-Proxy: Received: by mailuser.nyi.internal (Postfix, from userid 501) id 11AABE03EA; Wed, 17 Jul 2019 21:49:30 -0400 (EDT) X-Mailer: MessagingEngine.com Webmail Interface User-Agent: Cyrus-JMAP/3.1.6-731-g19d3b16-fmstable-20190627v1 Mime-Version: 1.0 Message-Id: In-Reply-To: References: <20190712033214.24713-1-andrew@aj.id.au> <20190712033214.24713-2-andrew@aj.id.au> <3fe55ea9-b949-48a0-9eab-90ad3bc1ee2a@www.fastmail.com> Date: Thu, 18 Jul 2019 11:19:40 +0930 From: "Andrew Jeffery" To: "Rob Herring" Cc: linux-mmc , "Ulf Hansson" , "Mark Rutland" , "Joel Stanley" , "Adrian Hunter" , devicetree@vger.kernel.org, "moderated list:ARM/FREESCALE IMX / MXC ARM ARCHITECTURE" , linux-aspeed@lists.ozlabs.org, "linux-kernel@vger.kernel.org" , "Ryan Chen" Subject: Re: [PATCH v2 1/2] dt-bindings: mmc: Document Aspeed SD controller Content-Type: text/plain Sender: linux-kernel-owner@vger.kernel.org Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org On Wed, 17 Jul 2019, at 23:13, Rob Herring wrote: > On Tue, Jul 16, 2019 at 9:58 PM Andrew Jeffery wrote: > > > > > > > > On Wed, 17 Jul 2019, at 00:27, Rob Herring wrote: > > > On Mon, Jul 15, 2019 at 6:36 PM Andrew Jeffery wrote: > > > > > > > > > > > > > > > > On Tue, 16 Jul 2019, at 07:47, Rob Herring wrote: > > > > > On Thu, Jul 11, 2019 at 9:32 PM Andrew Jeffery wrote: > > > > > > > > > > > > The ASPEED SD/SDIO/eMMC controller exposes two slots implementing the > > > > > > SDIO Host Specification v2.00, with 1 or 4 bit data buses, or an 8 bit > > > > > > data bus if only a single slot is enabled. > > > > > > > > > > > > Signed-off-by: Andrew Jeffery > > > > > > --- > > > > > > In v2: > > > > > > > > > > > > * Rename to aspeed,sdhci.yaml > > > > > > * Rename sd-controller compatible > > > > > > * Add `maxItems: 1` for reg properties > > > > > > * Move sdhci subnode description to patternProperties > > > > > > * Drop sdhci compatible requirement > > > > > > * #address-cells and #size-cells are required > > > > > > * Prevent additional properties > > > > > > * Implement explicit ranges in example > > > > > > * Remove slot property > > > > > > > > > > > > .../devicetree/bindings/mmc/aspeed,sdhci.yaml | 90 +++++++++++++++++++ > > > > > > 1 file changed, 90 insertions(+) > > > > > > create mode 100644 Documentation/devicetree/bindings/mmc/aspeed,sdhci.yaml > > > > > > > > > > > > diff --git a/Documentation/devicetree/bindings/mmc/aspeed,sdhci.yaml b/Documentation/devicetree/bindings/mmc/aspeed,sdhci.yaml > > > > > > new file mode 100644 > > > > > > index 000000000000..67a691c3348c > > > > > > --- /dev/null > > > > > > +++ b/Documentation/devicetree/bindings/mmc/aspeed,sdhci.yaml > > > > > > @@ -0,0 +1,90 @@ > > > > > > +# SPDX-License-Identifier: GPL-2.0-or-later > > > > > > +%YAML 1.2 > > > > > > +--- > > > > > > +$id: http://devicetree.org/schemas/mmc/aspeed,sdhci.yaml# > > > > > > +$schema: http://devicetree.org/meta-schemas/core.yaml# > > > > > > + > > > > > > +title: ASPEED SD/SDIO/eMMC Controller > > > > > > + > > > > > > +maintainers: > > > > > > + - Andrew Jeffery > > > > > > + - Ryan Chen > > > > > > + > > > > > > +description: |+ > > > > > > + The ASPEED SD/SDIO/eMMC controller exposes two slots implementing the SDIO > > > > > > + Host Specification v2.00, with 1 or 4 bit data buses, or an 8 bit data bus if > > > > > > + only a single slot is enabled. > > > > > > + > > > > > > + The two slots are supported by a common configuration area. As the SDHCIs for > > > > > > + the slots are dependent on the common configuration area, they are described > > > > > > + as child nodes. > > > > > > + > > > > > > +properties: > > > > > > + compatible: > > > > > > + enum: [ aspeed,ast2400-sd-controller, aspeed,ast2500-sd-controller ] > > > > > > > > > > This is actually a list of 4 strings. Please reformat to 1 per line. > > > > > > > > On reflection that's obvious, but also a somewhat subtle interaction with the > > > > preference for no quotes (the obvious caveat being "except where required"). > > > > > > It wasn't something I'd run into before. I'm working on a check, but > > > unfortunately we can only check for quotes not needed and can't check > > > for missing quotes. > > > > > > > Thanks for pointing it out. > > > > > > > > I have been running `make dt_binding_check` and `make dtbs_check` over > > > > these, looks like I need to up my game a bit though. Do you do additional things > > > > in your workflow? > > > > > > That should have thrown the warnings. If you aren't seeing those, do > > > you have dtschema package installed (see > > > Documentation/devicetree/writing-schema.md)? > > > > I do have it installed, but as mentioned previously there's a fair few > > warnings emitted currently by the Aspeed devicetrees, so it might have > > got lost in the noise. I've started to clean that up, though probably need > > some direction there too. > > > > Separately I'm currently trying to track down an issue where I get errors > > on the Aspeed dts cpu nodes about failing to match the riscv CPU > > compatibles, it seems dt-validate isn't finding the ARM CPU compatible > > strings. It feels more annoying to track down that I'd like. > > There's a fix in today's linux-next for that and it should be in > Linus' tree in a few days. > Thanks, I'll take a look. Andrew