Received: by 2002:a25:31c3:0:0:0:0:0 with SMTP id x186csp2794109ybx; Fri, 8 Nov 2019 09:23:48 -0800 (PST) X-Google-Smtp-Source: APXvYqzD2g77eKbM+bno82GmmmdbIxi6lGs7DhxdqQIQ6nxjDgtdgQxiXpCeT0xd2EDooluRC+yo X-Received: by 2002:a05:6402:2d6:: with SMTP id b22mr11601823edx.133.1573233827905; Fri, 08 Nov 2019 09:23:47 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1573233827; cv=none; d=google.com; s=arc-20160816; b=AUkogGPzirt/vz+HT9PbhhUTOSIffCvGlVjeSdRq91esghuyLsKXzXy2nBXxG96+FZ ZRiP98vMRApuKmz1JOQr9BbgJdkWJIePNe+45qJQcJB+C99xTDMH6E64YjYmKlTCstnT +j4oan9vZ0ZrIDkTWQfekGy1PNmg4FS2tzANdj5a0RFbo3B0YmBJmEm9MKsfs3B8jn0w GJ2KV0anExQVYt577/IzMB+FCYhXs4GD9Q3agIvZa03V8zLXCXfuU0RJ00rxvRE2aso0 TbrllG5Vo8YtcP9t+1dDuhj2duTKMS47fn85h9Iocn9xcr4meRk/LdTEl6hUMuS0/N3A TfYw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:sender:mime-version:user-agent:references :message-id:in-reply-to:subject:cc:to:from:date; bh=Atuo1qLGtc4/1wu9zMjFkK49X/tW5r7hy7cNOZ9rLpw=; b=VPYpZBs6NfXjrL0NC2xkXmCtbS72pJQK4z1lXCi7K6/ZsWODsES1jhX0n57Q4kKQjO ZqaY5f4Cl7JmZfspnIVrdF4MDu1u+1ezdVQsq0NmXvY0qXgCucDeEDlTi1vCZEOywazV NpTM4R8AkPPhlKwtKEh5Q7OparTvi/e49akKi8iQab9YRiFqe5Ym4nI4X2PpyWDdMe5j vCN2ZW8XoMn9JcO+VG3kbXs+FDI46/U34o4RmLpDaOvOUqhhXDuIto2axJF5IFzkXw8h UndYaSX9zTMHoiZJURnPaPvRuwkGKrd2rBi68BhnQSjfFZjxysXd0fJjg7Hns0IvvCRA 4VBQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from vger.kernel.org (vger.kernel.org. [209.132.180.67]) by mx.google.com with ESMTP id 11si5315586edv.422.2019.11.08.09.23.20; Fri, 08 Nov 2019 09:23:47 -0800 (PST) Received-SPF: pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) client-ip=209.132.180.67; Authentication-Results: mx.google.com; spf=pass (google.com: best guess record for domain of linux-kernel-owner@vger.kernel.org designates 209.132.180.67 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1727794AbfKHRWd (ORCPT + 99 others); Fri, 8 Nov 2019 12:22:33 -0500 Received: from tragedy.dreamhost.com ([66.33.205.236]:50352 "EHLO tragedy.dreamhost.com" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S1726049AbfKHRWd (ORCPT ); Fri, 8 Nov 2019 12:22:33 -0500 Received: from localhost (localhost [127.0.0.1]) by tragedy.dreamhost.com (Postfix) with ESMTPS id 0F93115F884; Fri, 8 Nov 2019 09:22:29 -0800 (PST) Date: Fri, 8 Nov 2019 17:22:28 +0000 (UTC) From: Sage Weil X-X-Sender: sage@piezo.novalocal To: Luis Henriques cc: Ilya Dryomov , Jeff Layton , "Yan, Zheng" , Ceph Development , LKML Subject: Re: [RFC PATCH 0/2] ceph: safely use 'copy-from' Op on Octopus OSDs In-Reply-To: <20191108171616.GA2569@hermes.olymp> Message-ID: References: <20191108141555.31176-1-lhenriques@suse.com> <20191108164758.GA1760@hermes.olymp> <20191108171616.GA2569@hermes.olymp> User-Agent: Alpine 2.21 (DEB 202 2017-01-01) MIME-Version: 1.0 Content-Type: text/plain; charset=US-ASCII X-VR-STATUS: OK X-VR-SCORE: -100 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedufedruddvuddguddtvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucggtfgfnhhsuhgsshgtrhhisggvpdfftffgtefojffquffvnecuuegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpeffhffvufgjkfhffgggtgesthdtredttdervdenucfhrhhomhepufgrghgvucghvghilhcuoehsrghgvgesnhgvfigurhgvrghmrdhnvghtqeenucfkphepuddvjedrtddrtddrudenucfrrghrrghmpehmohguvgepshhmthhppdhhvghloheplhhotggrlhhhohhsthdpihhnvghtpeduvdejrddtrddtrddupdhrvghtuhhrnhdqphgrthhhpefurghgvgcuhggvihhluceoshgrghgvsehnvgifughrvggrmhdrnhgvtheqpdhmrghilhhfrhhomhepshgrghgvsehnvgifughrvggrmhdrnhgvthdpnhhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgnecuvehluhhsthgvrhfuihiivgeptd Sender: linux-kernel-owner@vger.kernel.org Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org On Fri, 8 Nov 2019, Luis Henriques wrote: > On Fri, Nov 08, 2019 at 04:57:27PM +0000, Sage Weil wrote: > > On Fri, 8 Nov 2019, Luis Henriques wrote: > > > On Fri, Nov 08, 2019 at 04:15:35PM +0100, Ilya Dryomov wrote: > > > > If the OSD checked for unknown flags, like newer syscalls do, it would > > > > be super easy, but it looks like it doesn't. > > > > > > > > An obvious solution is to look at require_osd_release in osdmap, but we > > > > don't decode that in the kernel because it lives the OSD portion of the > > > > osdmap. We could add that and consider the fact that the client now > > > > needs to decode more than just the client portion a design mistake. > > > > I'm not sure what can of worms does that open and if copy-from alone is > > > > worth it though. Perhaps that field could be moved to (or a copy of it > > > > be replicated in) the client portion of the osdmap starting with > > > > octopus? We seem to be running into it on the client side more and > > > > more... > > > > > > I can't say I'm thrilled with the idea of going back to hack into the > > > OSDs code again, I was hoping to be able to handle this with the > > > information we already have on the connection peer_features field. It > > > took me *months* to have the OSD fix merged in so I'm not really > > > convinced a change to the osdmap would make it into Octopus :-) > > > > > > (But I'll have a look at this and see if I can understand what moving or > > > replicating the field in the osdmap would really entail.) > > > > Adding a copy of require_osd_release in the client portion of the map is > > an easy thing to do (and probably where it should have gone in the first > > place!). Let's do that! > > Yeah, after sending my reply to Ilya I took a quick look and it _seems_ > to be as easy as adding a new encode(require_osd_release...) in the > OSDMap. And handle the versions, of course. Let me spend some time > playing with that and I'll try to come up with something during the next > few days. - You'll need to add it for both OSDMap::Incremental and OSDMap - You'll need to make the encoding condition by updating the block like the one below from OSDMap::encode() uint8_t v = 9; if (!HAVE_FEATURE(features, SERVER_LUMINOUS)) { v = 3; } else if (!HAVE_FEATURE(features, SERVER_MIMIC)) { v = 6; } else if (!HAVE_FEATURE(features, SERVER_NAUTILUS)) { v = 7; } to include a SERVER_OCTOPUS case too. Same goes for Incremental::encode() sage