Received: by 2002:a05:6a10:8c0a:0:0:0:0 with SMTP id go10csp4287444pxb; Mon, 8 Feb 2021 12:29:58 -0800 (PST) X-Google-Smtp-Source: ABdhPJwlXSg+TPauOeXsAJ2V19zYJ4VSTFlmzw3AUMINCqVAroKfREi4akNWWHNU3kl9rCJ6WRMX X-Received: by 2002:a17:906:2993:: with SMTP id x19mr17847984eje.409.1612816198444; Mon, 08 Feb 2021 12:29:58 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1612816198; cv=none; d=google.com; s=arc-20160816; b=Oh1xKNr9v9Beo0WR1T/PkJt5cksQ96mfbdzFCMp5Uzd9LwvCtGGFsfm6zCd2X737Sg oNJpGSQBSiX5luxbWon6lvVKZYjRAzniKy3WvpkCpnf3jI3nuiwKVv2ha2fA/xBOeWDQ 3Q9MfOqTd/WZ4nRQal0k9G/8jk/5o2BVkTepDeVS1w8Dqmcw1fClqukMNIzkmD7q1Jxv kZWHyDu+RnJGM1I4Kp+7GsQXS8qYXe0CuVAnNuN73tGgpsbPck55U4bXaXlUSqKhZdJd MwxJOsttQT9znfglOeyBGEkAswhqoivb3uDVgIh9t/ysHInV10e8Bc/OamLIm5WUb/eL Nifg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=RM4sQL0DCUQPSGzC8vCAPRWAihpaENA+kQkWU6hYyBM=; b=B3ICuniHG1JRlavLDTrLLn/hJBbYhOUNeo8cTV9q6wIYc8o2wWFQ1HNOuISEpgWpNN pJyqZX7obxevc4wH7n9ZNSqD0BIlgtd0BjNYiABamCjuZJF6wlc2z944EU45mPjrBdk0 b9kKSgov/XWGMuloe6FTCh+JAbJE1sOmcFruyxzGN8hdgLt2xCr/l7qBKHM61EnV7xuT 5uSP0/6jsOTkCeiZL/bN7CW8b+zXWV7NrCA4bAFGOgIKgIEJc9z9y+yg7H/l8DIklrwu 6ifpmOi4KCNyyTIa2vAzJg4zAvL9EFA6h23uMTYIlQEnad157wLzO3YwzJAX0Iw7+CdY q6wg== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from vger.kernel.org (vger.kernel.org. [23.128.96.18]) by mx.google.com with ESMTP id i4si11639202ejg.48.2021.02.08.12.29.35; Mon, 08 Feb 2021 12:29:58 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) client-ip=23.128.96.18; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S236868AbhBHU1w (ORCPT + 99 others); Mon, 8 Feb 2021 15:27:52 -0500 Received: from cloudserver094114.home.pl ([79.96.170.134]:64096 "EHLO cloudserver094114.home.pl" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S232897AbhBHTFS (ORCPT ); Mon, 8 Feb 2021 14:05:18 -0500 Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_smtp) via UNIX with SMTP (IdeaSmtpServer 0.83.537) id f271e82a41dea252; Mon, 8 Feb 2021 20:04:28 +0100 Received: from kreacher.localnet (89-64-80-68.dynamic.chello.pl [89.64.80.68]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 3659A6608B3; Mon, 8 Feb 2021 20:04:28 +0100 (CET) From: "Rafael J. Wysocki" To: Peter Zijlstra , Paul McKenney Cc: Linux PM , LKML , Frederic Weisbecker Subject: WARNING: suspicious RCU usage (5.11.0-rc7+ #1812 Tainted: G) Date: Mon, 08 Feb 2021 20:04:27 +0100 Message-ID: <2578278.ATerS0GEoy@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="us-ascii" X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduledrheefgdduvddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffufffkggfgtgesthfuredttddtvdenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeevudefgfeguedtjedvhfetveegleduveeuvedvjeekleefhfduhfefheekffefveenucfkphepkeelrdeigedrkedtrdeikeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeekledrieegrdektddrieekpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepphgruhhlmhgtkheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepfhhrvgguvghrihgtsehkvghrnhgvlhdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Hi Peter & Paul, The traces below are present in the boot dmesg log on my Dell XPS13 9360. I haven't had the time to look into this in detail yet, but here it goes in case you know what's going on already. Cheers! [ 86.762542] IPv6: ADDRCONF(NETDEV_CHANGE): wlan0: link becomes ready [ 86.764298] ============================= [ 86.764300] WARNING: suspicious RCU usage [ 86.764302] 5.11.0-rc7+ #1812 Tainted: G I [ 86.764305] ----------------------------- [ 86.764307] /scratch/rafael/work/linux-pm/include/linux/rhashtable.h:594 suspicious rcu_dereference_check() usage! [ 86.764309] other info that might help us debug this: [ 86.764311] rcu_scheduler_active = 2, debug_locks = 1 [ 86.764313] no locks held by swapper/1/0. [ 86.764316] stack backtrace: [ 86.764318] CPU: 1 PID: 0 Comm: swapper/1 Tainted: G I 5.11.0-rc7+ #1812 [ 86.764321] Hardware name: Dell Inc. XPS 13 9360/, BIOS 1.3.5 05/08/2017 [ 86.764323] Call Trace: [ 86.764325] [ 86.764328] dump_stack+0x77/0x97 [ 86.764336] ieee80211_find_sta_by_ifaddr+0x218/0x2e0 [mac80211] [ 86.764380] ? ath10k_wmi_tlv_op_pull_mgmt_tx_bundle_compl_ev+0xe0/0xe0 [ath10k_core] [ 86.764399] ath10k_wmi_tlv_parse_peer_stats_info+0x2a/0x70 [ath10k_core] [ 86.764411] ath10k_wmi_tlv_iter+0x56/0xd0 [ath10k_core] [ 86.764424] ath10k_wmi_tlv_op_rx+0x75a/0xa30 [ath10k_core] [ 86.764438] ath10k_htc_rx_completion_handler+0xe8/0x120 [ath10k_core] [ 86.764452] ? ath10k_htc_process_trailer+0x290/0x290 [ath10k_core] [ 86.764462] ath10k_pci_process_rx_cb+0x117/0x180 [ath10k_pci] [ 86.764472] ? ath10k_ce_per_engine_service+0x4c/0x80 [ath10k_core] [ 86.764490] ? _raw_spin_unlock_irqrestore+0x47/0x60 [ 86.764504] ath10k_ce_per_engine_service+0x5d/0x80 [ath10k_core] [ 86.764524] ath10k_ce_per_engine_service_any+0x6a/0xa0 [ath10k_core] [ 86.764543] ath10k_pci_napi_poll+0x44/0x110 [ath10k_pci] [ 86.764552] net_rx_action+0x15d/0x4e0 [ 86.764570] __do_softirq+0xeb/0x492 [ 86.764583] ? handle_fasteoi_irq+0x150/0x150 [ 86.764591] asm_call_irq_on_stack+0x12/0x20 [ 86.764598] [ 86.764602] do_softirq_own_stack+0x81/0xa0 [ 86.764609] irq_exit_rcu+0xcd/0xe0 [ 86.764614] common_interrupt+0xfe/0x230 [ 86.764623] asm_common_interrupt+0x1e/0x40 [ 86.764626] RIP: 0010:cpuidle_enter_state+0x109/0x4a0 [ 86.764631] Code: 02 00 00 31 ff e8 b7 40 8e ff 45 84 ff 74 12 9c 58 f6 c4 02 0f 85 10 03 00 00 31 ff e8 70 42 96 ff e8 bb a2 9d ff fb 45 85 f6 <0f> 88 12 01 00 00 49 63 d6 4c 2b 24 24 48 8d 04 52 48 8d 04 82 49 [ 86.764634] RSP: 0018:ffffc900000e3e80 EFLAGS: 00000202 [ 86.764638] RAX: 00000000000e8d89 RBX: 0000000000000002 RCX: 0000000000000000 [ 86.764641] RDX: 0000000000000000 RSI: ffffffff82392561 RDI: ffffffff82344126 [ 86.764643] RBP: ffffe8ffffc93300 R08: 0000000000000001 R09: 0000000000000001 [ 86.764645] R10: ffffc900000e3e60 R11: 0000000000000002 R12: 00000014338d5797 [ 86.764647] R13: ffffffff827e6d60 R14: 0000000000000002 R15: 0000000000000000 [ 86.764667] cpuidle_enter+0x29/0x40 [ 86.764672] do_idle+0x22d/0x2b0 [ 86.764682] cpu_startup_entry+0x19/0x20 [ 86.764686] start_secondary+0x125/0x160 [ 86.764691] secondary_startup_64_no_verify+0xb0/0xbb [ 86.764710] ============================= [ 86.764712] WARNING: suspicious RCU usage [ 86.764714] 5.11.0-rc7+ #1812 Tainted: G I [ 86.764716] ----------------------------- [ 86.764718] /scratch/rafael/work/linux-pm/include/linux/rhashtable.h:369 suspicious rcu_dereference_check() usage! [ 86.764720] other info that might help us debug this: [ 86.764722] rcu_scheduler_active = 2, debug_locks = 1 [ 86.764724] no locks held by swapper/1/0. [ 86.764726] stack backtrace: [ 86.764728] CPU: 1 PID: 0 Comm: swapper/1 Tainted: G I 5.11.0-rc7+ #1812 [ 86.764730] Hardware name: Dell Inc. XPS 13 9360/, BIOS 1.3.5 05/08/2017 [ 86.764732] Call Trace: [ 86.764734] [ 86.764737] dump_stack+0x77/0x97 [ 86.764742] ieee80211_find_sta_by_ifaddr+0x249/0x2e0 [mac80211] [ 86.764781] ? ath10k_wmi_tlv_op_pull_mgmt_tx_bundle_compl_ev+0xe0/0xe0 [ath10k_core] [ 86.764795] ath10k_wmi_tlv_parse_peer_stats_info+0x2a/0x70 [ath10k_core] [ 86.764806] ath10k_wmi_tlv_iter+0x56/0xd0 [ath10k_core] [ 86.764819] ath10k_wmi_tlv_op_rx+0x75a/0xa30 [ath10k_core] [ 86.764833] ath10k_htc_rx_completion_handler+0xe8/0x120 [ath10k_core] [ 86.764845] ? ath10k_htc_process_trailer+0x290/0x290 [ath10k_core] [ 86.764856] ath10k_pci_process_rx_cb+0x117/0x180 [ath10k_pci] [ 86.764865] ? ath10k_ce_per_engine_service+0x4c/0x80 [ath10k_core] [ 86.764876] ? _raw_spin_unlock_irqrestore+0x47/0x60 [ 86.764885] ath10k_ce_per_engine_service+0x5d/0x80 [ath10k_core] [ 86.764897] ath10k_ce_per_engine_service_any+0x6a/0xa0 [ath10k_core] [ 86.764908] ath10k_pci_napi_poll+0x44/0x110 [ath10k_pci] [ 86.764915] net_rx_action+0x15d/0x4e0 [ 86.764927] __do_softirq+0xeb/0x492 [ 86.764934] ? handle_fasteoi_irq+0x150/0x150 [ 86.764940] asm_call_irq_on_stack+0x12/0x20 [ 86.764944] [ 86.764946] do_softirq_own_stack+0x81/0xa0 [ 86.764951] irq_exit_rcu+0xcd/0xe0 [ 86.764954] common_interrupt+0xfe/0x230 [ 86.764961] asm_common_interrupt+0x1e/0x40 [ 86.764964] RIP: 0010:cpuidle_enter_state+0x109/0x4a0 [ 86.764967] Code: 02 00 00 31 ff e8 b7 40 8e ff 45 84 ff 74 12 9c 58 f6 c4 02 0f 85 10 03 00 00 31 ff e8 70 42 96 ff e8 bb a2 9d ff fb 45 85 f6 <0f> 88 12 01 00 00 49 63 d6 4c 2b 24 24 48 8d 04 52 48 8d 04 82 49 [ 86.764970] RSP: 0018:ffffc900000e3e80 EFLAGS: 00000202 [ 86.764974] RAX: 00000000000e8d89 RBX: 0000000000000002 RCX: 0000000000000000 [ 86.764976] RDX: 0000000000000000 RSI: ffffffff82392561 RDI: ffffffff82344126 [ 86.764978] RBP: ffffe8ffffc93300 R08: 0000000000000001 R09: 0000000000000001 [ 86.764980] R10: ffffc900000e3e60 R11: 0000000000000002 R12: 00000014338d5797 [ 86.764983] R13: ffffffff827e6d60 R14: 0000000000000002 R15: 0000000000000000 [ 86.765002] cpuidle_enter+0x29/0x40 [ 86.765007] do_idle+0x22d/0x2b0 [ 86.765019] cpu_startup_entry+0x19/0x20 [ 86.765025] start_secondary+0x125/0x160 [ 86.765031] secondary_startup_64_no_verify+0xb0/0xbb [ 88.867292] pcieport 0000:00:1c.4: AER: Corrected error received: 0000:00:1c.4 [ 88.867348] pcieport 0000:00:1c.4: PCIe Bus Error: severity=Corrected, type=Data Link Layer, (Transmitter ID) [ 88.867351] pcieport 0000:00:1c.4: device [8086:9d14] error status/mask=00001000/00002000 [ 88.867354] pcieport 0000:00:1c.4: [12] Timeout [ 95.481009] pcieport 0000:00:1c.4: AER: Corrected error received: 0000:00:1c.4 [ 95.481024] pcieport 0000:00:1c.4: PCIe Bus Error: severity=Corrected, type=Data Link Layer, (Transmitter ID) [ 95.481028] pcieport 0000:00:1c.4: device [8086:9d14] error status/mask=00001000/00002000 [ 95.481031] pcieport 0000:00:1c.4: [12] Timeout