Received: by 2002:a05:6a10:8c0a:0:0:0:0 with SMTP id go10csp5171386pxb; Mon, 15 Feb 2021 11:27:26 -0800 (PST) X-Google-Smtp-Source: ABdhPJwu20XBH95gMBING01UT95M5kflgeGkyvyFWVNhpJyVXNi53ByIPI4h9W9MrNw5cg99LLiq X-Received: by 2002:a17:906:a2da:: with SMTP id by26mr17892656ejb.191.1613417246508; Mon, 15 Feb 2021 11:27:26 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1613417246; cv=none; d=google.com; s=arc-20160816; b=lNLo8RPI8pTjzCdjgf25vcMEfCnAqfNqkq/IE09lpKLaFqtZOrMYj7RT0sBq1YIIqA rsJyKVp3NsfpvG/QcgxmISVbfsiwQgjbxk7rSizHcSukwY4mp2y9Y+mrKEEUvr9tB3sO IOseAUfCaq708Xy4Wxu9WZxlpM46/weYN2Z1LwV2Kv4CecGeJehOy2WvK1KB2hjbXHRv z/R5APQk+utlmMJ9VIhXrvcPrJe82hd3rI+e7cMG4wbA8OkFj7gIzGmeJ9mHhritmTz1 9eJfa3cA4iEjUpjVoTaYnxuBfSwp3DCzICj36hZYWpDIc1njloUVjtpEG2EK3vfYtgua 36eQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :message-id:date:subject:cc:to:from; bh=qo08y7NtR8YfYG/dWT4LfjinNCDQkCEiOXYXVNJuy9Y=; b=WH/lzkYeb5Xe61Jy/ops/nEm7S4Q0bO8oXOm41Jvz2qak+2MUlsOSza8hHqwzGFEAV 4EBrhks7mzkOQDPdWc2V+a0ypy0BV9gHiPGWZgnJU+/Nbx7cvVuEqGlnBcYhdYdgC5dk f9mWOe9ldWtKLJCFtkIbuzh+AiUAr7G3Le0K/qSD/3ZPUO9/VZbPDh7ZJV+Qvds0is0W lyveXaLsIGEckko/0HzlRPDDPXf9LLS+WAsbuocEZUbHHp061vM8DWkrdYERtFL975d7 k3ot1TqEj6fiNvaojmGNxSLdkqlr1yenS7WwFzm46LyWNXAZUU5UirAPfcT2ajhBp+MI kRrQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from vger.kernel.org (vger.kernel.org. [23.128.96.18]) by mx.google.com with ESMTP id b13si15437263ede.66.2021.02.15.11.27.02; Mon, 15 Feb 2021 11:27:26 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) client-ip=23.128.96.18; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230031AbhBOTZf (ORCPT + 99 others); Mon, 15 Feb 2021 14:25:35 -0500 Received: from cloudserver094114.home.pl ([79.96.170.134]:62620 "EHLO cloudserver094114.home.pl" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229981AbhBOTZc (ORCPT ); Mon, 15 Feb 2021 14:25:32 -0500 Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_smtp) via UNIX with SMTP (IdeaSmtpServer 0.83.537) id 472bc93a69a25bc3; Mon, 15 Feb 2021 20:24:48 +0100 Received: from kreacher.localnet (89-64-82-54.dynamic.chello.pl [89.64.82.54]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id CB7A1661D7E; Mon, 15 Feb 2021 20:24:46 +0100 (CET) From: "Rafael J. Wysocki" To: Linux PM , Giovanni Gherdovich , Michael Larabel Cc: LKML , Linux ACPI , Peter Zijlstra , Srinivas Pandruvada , Viresh Kumar , Mel Gorman , Juri Lelli , Vincent Guittot Subject: [RFT][PATCH v1] cpufreq: ACPI: Set cpuinfo.max_freq directly if max boost is known Date: Mon, 15 Feb 2021 20:24:46 +0100 Message-ID: <1974978.nRy8TqEeLZ@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="us-ascii" X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduledrieekgdduvddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffufffkggfgtgesthfuredttddtvdenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeeiueevhfeigffhffevueekgedtleeitdfhffejleevtddvtdettedvfffffffhjeenucffohhmrghinhepkhgvrhhnvghlrdhorhhgnecukfhppeekledrieegrdekvddrheegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepkeelrdeigedrkedvrdehgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehgghhhvghrughovhhitghhsehsuhhsvgdrtgiipdhrtghpthhtohepofhitghhrggvlhesphhhohhrohhnihigrdgtohhmpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqrggt phhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtohepphgvthgvrhiisehinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehvihhrvghshhdrkhhumhgrrheslhhinhgrrhhordhorhhgpdhrtghpthhtohepmhhgohhrmhgrnhesthgvtghhshhinhhguhhlrghrihhthidrnhgvthdprhgtphhtthhopehjuhhrihdrlhgvlhhlihesrhgvughhrghtrdgtohhmpdhrtghpthhtohepvhhinhgtvghnthdrghhuihhtthhotheslhhinhgrrhhordhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=11 Fuz1=11 Fuz2=11 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org From: Rafael J. Wysocki Commit 3c55e94c0ade ("cpufreq: ACPI: Extend frequency tables to cover boost frequencies") attempted to address a performance issue involving acpi-cpufreq, the schedutil governor and scale-invariance on x86 by extending the frequency tables created by acpi-cpufreq to cover the entire range of "turbo" (or "boost") frequencies, but that caused frequencies reported via /proc/cpuinfo and the scaling_cur_freq attribute in sysfs to change which may confuse users and monitoring tools. For this reason, revert the part of commit 3c55e94c0ade adding the extra entry to the frequency table and use the observation that in principle cpuinfo.max_freq need not be equal to the maximum frequency listed in the frequency table for the given policy. Namely, modify cpufreq_frequency_table_cpuinfo() to allow cpufreq drivers to set their own cpuinfo.max_freq above that frequency and change acpi-cpufreq to set cpuinfo.max_freq to the maximum boost frequency found via CPPC. This should be sufficient to let all of the cpufreq subsystem know the real maximum frequency of the CPU without changing frequency reporting. Link: https://bugzilla.kernel.org/show_bug.cgi?id=211305 Fixes: 3c55e94c0ade ("cpufreq: ACPI: Extend frequency tables to cover boost frequencies") Reported-by: Matt McDonald Signed-off-by: Rafael J. Wysocki --- Michael, Giovanni, The fix for the EPYC performance regression that was merged into 5.11 introduced an undesirable side-effect by distorting the CPU frequency reporting via /proc/cpuinfo and scaling_cur_freq (see the BZ link above for details). The patch below is reported to address this problem and it should still allow schedutil to achieve desirable performance, because it simply sets cpuinfo.max_freq without extending the frequency table of the CPU. Please test this one and let me know if it adversely affects performance. Thanks! --- drivers/cpufreq/acpi-cpufreq.c | 62 ++++++++++------------------------------- drivers/cpufreq/freq_table.c | 8 ++++- 2 files changed, 23 insertions(+), 47 deletions(-) Index: linux-pm/drivers/cpufreq/acpi-cpufreq.c =================================================================== --- linux-pm.orig/drivers/cpufreq/acpi-cpufreq.c +++ linux-pm/drivers/cpufreq/acpi-cpufreq.c @@ -54,7 +54,6 @@ struct acpi_cpufreq_data { unsigned int resume; unsigned int cpu_feature; unsigned int acpi_perf_cpu; - unsigned int first_perf_state; cpumask_var_t freqdomain_cpus; void (*cpu_freq_write)(struct acpi_pct_register *reg, u32 val); u32 (*cpu_freq_read)(struct acpi_pct_register *reg); @@ -223,10 +222,10 @@ static unsigned extract_msr(struct cpufr perf = to_perf_data(data); - cpufreq_for_each_entry(pos, policy->freq_table + data->first_perf_state) + cpufreq_for_each_entry(pos, policy->freq_table) if (msr == perf->states[pos->driver_data].status) return pos->frequency; - return policy->freq_table[data->first_perf_state].frequency; + return policy->freq_table[0].frequency; } static unsigned extract_freq(struct cpufreq_policy *policy, u32 val) @@ -365,7 +364,6 @@ static unsigned int get_cur_freq_on_cpu( struct cpufreq_policy *policy; unsigned int freq; unsigned int cached_freq; - unsigned int state; pr_debug("%s (%d)\n", __func__, cpu); @@ -377,11 +375,7 @@ static unsigned int get_cur_freq_on_cpu( if (unlikely(!data || !policy->freq_table)) return 0; - state = to_perf_data(data)->state; - if (state < data->first_perf_state) - state = data->first_perf_state; - - cached_freq = policy->freq_table[state].frequency; + cached_freq = policy->freq_table[to_perf_data(data)->state].frequency; freq = extract_freq(policy, get_cur_val(cpumask_of(cpu), data)); if (freq != cached_freq) { /* @@ -680,7 +674,6 @@ static int acpi_cpufreq_cpu_init(struct struct cpuinfo_x86 *c = &cpu_data(cpu); unsigned int valid_states = 0; unsigned int result = 0; - unsigned int state_count; u64 max_boost_ratio; unsigned int i; #ifdef CONFIG_SMP @@ -795,28 +788,8 @@ static int acpi_cpufreq_cpu_init(struct goto err_unreg; } - state_count = perf->state_count + 1; - - max_boost_ratio = get_max_boost_ratio(cpu); - if (max_boost_ratio) { - /* - * Make a room for one more entry to represent the highest - * available "boost" frequency. - */ - state_count++; - valid_states++; - data->first_perf_state = valid_states; - } else { - /* - * If the maximum "boost" frequency is unknown, ask the arch - * scale-invariance code to use the "nominal" performance for - * CPU utilization scaling so as to prevent the schedutil - * governor from selecting inadequate CPU frequencies. - */ - arch_set_max_freq_ratio(true); - } - - freq_table = kcalloc(state_count, sizeof(*freq_table), GFP_KERNEL); + freq_table = kcalloc(perf->state_count + 1, sizeof(*freq_table), + GFP_KERNEL); if (!freq_table) { result = -ENOMEM; goto err_unreg; @@ -851,27 +824,25 @@ static int acpi_cpufreq_cpu_init(struct } freq_table[valid_states].frequency = CPUFREQ_TABLE_END; + max_boost_ratio = get_max_boost_ratio(cpu); if (max_boost_ratio) { - unsigned int state = data->first_perf_state; - unsigned int freq = freq_table[state].frequency; + unsigned int freq = freq_table[0].frequency; /* * Because the loop above sorts the freq_table entries in the * descending order, freq is the maximum frequency in the table. * Assume that it corresponds to the CPPC nominal frequency and - * use it to populate the frequency field of the extra "boost" - * frequency entry. + * use it to set cpuinfo.max_freq. */ - freq_table[0].frequency = freq * max_boost_ratio >> SCHED_CAPACITY_SHIFT; + policy->cpuinfo.max_freq = freq * max_boost_ratio >> SCHED_CAPACITY_SHIFT; + } else { /* - * The purpose of the extra "boost" frequency entry is to make - * the rest of cpufreq aware of the real maximum frequency, but - * the way to request it is the same as for the first_perf_state - * entry that is expected to cover the entire range of "boost" - * frequencies of the CPU, so copy the driver_data value from - * that entry. + * If the maximum "boost" frequency is unknown, ask the arch + * scale-invariance code to use the "nominal" performance for + * CPU utilization scaling so as to prevent the schedutil + * governor from selecting inadequate CPU frequencies. */ - freq_table[0].driver_data = freq_table[state].driver_data; + arch_set_max_freq_ratio(true); } policy->freq_table = freq_table; @@ -947,8 +918,7 @@ static void acpi_cpufreq_cpu_ready(struc { struct acpi_processor_performance *perf = per_cpu_ptr(acpi_perf_data, policy->cpu); - struct acpi_cpufreq_data *data = policy->driver_data; - unsigned int freq = policy->freq_table[data->first_perf_state].frequency; + unsigned int freq = policy->freq_table[0].frequency; if (perf->states[0].core_frequency * 1000 != freq) pr_warn(FW_WARN "P-state 0 is not max freq\n"); Index: linux-pm/drivers/cpufreq/freq_table.c =================================================================== --- linux-pm.orig/drivers/cpufreq/freq_table.c +++ linux-pm/drivers/cpufreq/freq_table.c @@ -52,7 +52,13 @@ int cpufreq_frequency_table_cpuinfo(stru } policy->min = policy->cpuinfo.min_freq = min_freq; - policy->max = policy->cpuinfo.max_freq = max_freq; + policy->max = max_freq; + /* + * If the driver has set its own cpuinfo.max_freq above max_freq, leave + * it as is. + */ + if (policy->cpuinfo.max_freq < max_freq) + policy->max = policy->cpuinfo.max_freq = max_freq; if (policy->min == ~0) return -EINVAL;