Received: by 2002:a05:6a10:206:0:0:0:0 with SMTP id 6csp4505989pxj; Wed, 12 May 2021 07:07:23 -0700 (PDT) X-Google-Smtp-Source: ABdhPJwMgJhfs2+nHqP1fSClZ3FtUMpZBIRyj3Xu5fvb20fmeQ9BldrZyzErrYKeEbmwAVzJfM+K X-Received: by 2002:ac2:5e38:: with SMTP id o24mr26004988lfg.266.1620828443391; Wed, 12 May 2021 07:07:23 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1620828443; cv=none; d=google.com; s=arc-20160816; b=t+VVy+T3rPIeDzcFi9Bh9poEzV15WibwMcTIeZXyNZrkhTgkstdjmQZfvCy50uHQc0 WXF3WjXjZbhgVy7iOGjJ/YDtRUde6Jxwm3UT0iAupnCOZllrg1vi1qFnbLCbGkBEF6VS V16dmfMwt+V1uCmMdHJ9mhbUF808Oe7Z9u7EYwNPVkhhdeb5jvJGqVpWK8nP+oNNyyhy KyhteeIRZQUcloN0BJ3KoN1Db4ivPN0y4Ctkh46EHrF92q+6VA1JdVOif4McpyAMI7Wm nnDa9ixwZ3i5FWC/uU0EEPMbyk6ZaWFw0WpZ1H3BJcPihcfp2D9IufFPeJAYr4la9mwF /aMA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=ykfM25SRc36J6eVf9wHh0SzbtxymyyfjbK1yC4LsGWY=; b=lmBComdije11Io9bu0sLtmKhHsKa5ArmdAtDGJivJW+xbe+nK0VOdunwAJYD4xOkAk gnRlQ/MvPN7Tf0fcriJ1+Vq0M7+xISia4lKA33AjGyC0InykTyT01Gyon1TKpepLw+52 uTHLIcZcq4KS37L/2syblGppkAyK2IMHyxEbCsq35g4TB3hlLeWNZqEhVqH+WHPQGMha H8PYT68PN+zoiuB+nbX/qmllV9kGAp5kY+MxPsf41i/VrlWtZG//Rasqur6kDIkBVBJ7 i8PSuO1pet6CeVCQjdUs0GexVYJoNU0pkuxFu8e6Bkn0UEFf03RxHyRzbXBARb7F/GiP SEPQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from vger.kernel.org (vger.kernel.org. [23.128.96.18]) by mx.google.com with ESMTP id y10si41556lfe.162.2021.05.12.07.06.52; Wed, 12 May 2021 07:07:23 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) client-ip=23.128.96.18; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231274AbhELOGI convert rfc822-to-8bit (ORCPT + 99 others); Wed, 12 May 2021 10:06:08 -0400 Received: from cloudserver094114.home.pl ([79.96.170.134]:50640 "EHLO cloudserver094114.home.pl" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231185AbhELOGG (ORCPT ); Wed, 12 May 2021 10:06:06 -0400 Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 2.0.5) id 93a1e582fd97ef35; Wed, 12 May 2021 16:04:56 +0200 Received: from kreacher.localnet (89-64-81-242.dynamic.chello.pl [89.64.81.242]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C0D666695E7; Wed, 12 May 2021 16:04:55 +0200 (CEST) From: "Rafael J. Wysocki" To: "chenxiang (M)" Cc: "Rafael J. Wysocki" , John Garry , linuxarm@huawei.com, linux-scsi@vger.kernel.org, linux-kernel , Linux PM , Greg Kroah-Hartman , Saravana Kannan Subject: Re: Qestion about device link Date: Wed, 12 May 2021 16:04:55 +0200 Message-ID: <11764789.O9o76ZdvQC@kreacher> In-Reply-To: <1c1cd889-7e6f-79f7-2650-cd181abc56b2@hisilicon.com> References: <3c88cf35-6725-1bfa-9e1e-8e9d69147e3b@hisilicon.com> <2149723.iZASKD2KPV@kreacher> <1c1cd889-7e6f-79f7-2650-cd181abc56b2@hisilicon.com> MIME-Version: 1.0 Content-Transfer-Encoding: 8BIT Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 89.64.81.242 X-CLIENT-HOSTNAME: 89-64-81-242.dynamic.chello.pl X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgeduledrvdehvddgieekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffufffkjghfggfgtgesthhqredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpeeijeekfeehgeejffefveffgeehheetueevudeutddtvdetueegudehieeiheefveenucfkphepkeelrdeigedrkedurddvgedvnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepkeelrdeigedrkedurddvgedvpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhrtghpthhtoheptghhvghngihirghngheiieeshhhishhilhhitghonhdrtghomhdprhgtphhtthhopehrrghfrggvlhdrjhdrfiihshhotghkihesihhnthgvlhdrtghomhdprhgtphhtthhopehjohhhnhdrghgrrhhrhieshhhurgifvghirdgtohhmpdhrtghpthhtoheplhhinhhugigrrhhmsehhuhgrfigvihdrtghomhdprhgtphhtthhopehlihhnuhigqdhstghsihesvhhgvghrrdhkvghrnhgvlhdr ohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehgrhgvghhkhheslhhinhhugihfohhunhgurghtihhonhdrohhrghdprhgtphhtthhopehsrghrrghvrghnrghksehgohhoghhlvgdrtghomh X-DCC--Metrics: v370.home.net.pl 1024; Body=9 Fuz1=9 Fuz2=9 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org On Wednesday, May 12, 2021 5:24:53 AM CEST chenxiang (M) wrote: > Hi Rafael, > > > 在 2021/5/12 3:16, Rafael J. Wysocki 写道: > > On Tuesday, May 11, 2021 4:39:31 PM CEST Rafael J. Wysocki wrote: > >> On 5/11/2021 5:59 AM, chenxiang (M) wrote: > >>> Hi Rafael and other guys, > >>> > >>> I am trying to add a device link between scsi_host->shost_gendev and > >>> hisi_hba->dev to support runtime PM for hisi_hba driver > >>> > >>> (as it supports runtime PM for scsi host in some scenarios such as > >>> error handler etc, we can avoid to do them again if adding a > >>> > >>> device link between scsi_host->shost_gendev and hisi_hba->dev) as > >>> follows (hisi_sas driver is under directory drivers/scsi/hisi_sas): > >>> > >>> device_link_add(&shost->shost_gendev, hisi_hba->dev, > >>> DL_FLAG_PM_RUNTIME | DL_FLAG_RPM_ACTIVE) > >>> > >>> We have a full test on it, and it works well except when rmmod the > >>> driver, some call trace occurs as follows: > >>> > >>> [root@localhost ~]# rmmod hisi_sas_v3_hw > >>> [ 105.377944] BUG: scheduling while atomic: kworker/113:1/811/0x00000201 > >>> [ 105.384469] Modules linked in: bluetooth rfkill ib_isert > >>> iscsi_target_mod ib_ipoib ib_umad iptable_filter vfio_iommu_type1 > >>> vfio_pci vfio_virqfd vfio rpcrdma ib_is er > >>> libiscsi scsi_transport_iscsi crct10dif_ce sbsa_gwdt hns_roce_hw_v2 > >>> hisi_sec2 hisi_hpre hisi_zip hisi_qm uacce spi_hisi_sfc_v3xx > >>> hisi_trng_v2 rng_core hisi_uncore _hha_pmu > >>> hisi_uncore_ddrc_pmu hisi_uncore_l3c_pmu spi_dw_mmio hisi_uncore_pmu > >>> hns3 hclge hnae3 hisi_sas_v3_hw(-) hisi_sas_main libsas > >>> [ 105.424841] CPU: 113 PID: 811 Comm: kworker/113:1 Kdump: loaded > >>> Tainted: G W 5.12.0-rc1+ #1 > >>> [ 105.434454] Hardware name: Huawei TaiShan 2280 V2/BC82AMDC, BIOS > >>> 2280-V2 CS V5.B143.01 04/22/2021 > >>> [ 105.443287] Workqueue: rcu_gp srcu_invoke_callbacks > >>> [ 105.448154] Call trace: > >>> [ 105.450593] dump_backtrace+0x0/0x1a4 > >>> [ 105.454245] show_stack+0x24/0x40 > >>> [ 105.457548] dump_stack+0xc8/0x104 > >>> [ 105.460939] __schedule_bug+0x68/0x80 > >>> [ 105.464590] __schedule+0x73c/0x77c > >>> [ 105.465700] BUG: scheduling while atomic: kworker/96:1/791/0x00000201 > >>> [ 105.468066] schedule+0x7c/0x110 > >>> [ 105.468068] schedule_timeout+0x194/0x1d4 > >>> [ 105.474490] Modules linked in: > >>> [ 105.477692] wait_for_completion+0x8c/0x12c > >>> [ 105.477695] rcu_barrier+0x1e0/0x2fc > >>> [ 105.477697] scsi_host_dev_release+0x50/0xf0 > >>> [ 105.477701] device_release+0x40/0xa0 > >>> [ 105.477704] kobject_put+0xac/0x100 > >>> [ 105.477707] __device_link_free_srcu+0x50/0x74 > >>> [ 105.477709] srcu_invoke_callbacks+0x108/0x1a4 > >>> [ 105.484743] process_one_work+0x1dc/0x48c > >>> [ 105.492468] worker_thread+0x7c/0x464 > >>> [ 105.492471] kthread+0x168/0x16c > >>> [ 105.492473] ret_from_fork+0x10/0x18 > >>> ... > >>> > >>> After analyse the process, we find that it will > >>> device_del(&shost->gendev) in function scsi_remove_host() and then > >>> > >>> put_device(&shost->shost_gendev) in function scsi_host_put() when > >>> removing the driver, if there is a link between shost and hisi_hba->dev, > >>> > >>> it will try to delete the link in device_del(), and also will > >>> call_srcu(__device_link_free_srcu) to put_device() link->consumer and > >>> supplier. > >>> > >>> But if put device() for shost_gendev in device_link_free() is later > >>> than in scsi_host_put(), it will call scsi_host_dev_release() in > >>> > >>> srcu_invoke_callbacks() while it is atomic and there are scheduling in > >>> scsi_host_dev_release(), > >>> > >>> so it reports the BUG "scheduling while atomic:...". > >>> > >>> thread 1 thread2 > >>> hisi_sas_v3_remove > >>> ... > >>> sas_remove_host() > >>> ... > >>> scsi_remove_host() > >>> ... > >>> device_del(&shost->shost_gendev) > >>> ... > >>> device_link_purge() > >>> __device_link_del() > >>> device_unregister(&link->link_dev) > >>> devlink_dev_release > >>> call_srcu(__device_link_free_srcu) -----------> > >>> srcu_invoke_callbacks (atomic) > >>> __device_link_free_srcu > >>> ... > >>> scsi_host_put() > >>> put_device(&shost->shost_gendev) (ref = 1) > >>> device_link_free() > >>> put_device(link->consumer) > >>> //shost->gendev ref = 0 > >>> ... > >>> scsi_host_dev_release > >>> ... > >>> rcu_barrier > >>> kthread_stop() > >>> > >>> > >>> We can check kref of shost->shost_gendev to make sure scsi_host_put() > >>> to release scsi host device in LLDD driver to avoid the issue, > >>> > >>> but it seems be a common issue: function __device_link_free_srcu > >>> calls put_device() for consumer and supplier, > >>> > >>> but if it's ref =0 at that time and there are scheduling or sleep in > >>> dev_release, it may have the issue. > >>> > >>> Do you have any idea about the issue? > >>> > >> Yes, this is a general issue. > >> > >> If I'm not mistaken, it can be addressed by further deferring the > >> device_link_free() invocation through a workqueue. > >> > >> Let me cut a patch doing this. > > Please test the patch below and let me know if it works for you. > > I have a test on the patch, and it solves my issue. Great, thanks! Please also test the patch appended below (it uses a slightly different approach). --- drivers/base/core.c | 37 +++++++++++++++++++++++-------------- include/linux/device.h | 6 ++---- 2 files changed, 25 insertions(+), 18 deletions(-) Index: linux-pm/drivers/base/core.c =================================================================== --- linux-pm.orig/drivers/base/core.c +++ linux-pm/drivers/base/core.c @@ -193,6 +193,11 @@ int device_links_read_lock_held(void) { return srcu_read_lock_held(&device_links_srcu); } + +void device_link_synchronize_removal(void) +{ + synchronize_srcu(&device_links_srcu); +} #else /* !CONFIG_SRCU */ static DECLARE_RWSEM(device_links_lock); @@ -223,6 +228,10 @@ int device_links_read_lock_held(void) return lockdep_is_held(&device_links_lock); } #endif + +static inline void device_link_synchronize_removal(void) +{ +} #endif /* !CONFIG_SRCU */ static bool device_is_ancestor(struct device *dev, struct device *target) @@ -444,8 +453,13 @@ static struct attribute *devlink_attrs[] }; ATTRIBUTE_GROUPS(devlink); -static void device_link_free(struct device_link *link) +static void device_link_release_fn(struct work_struct *work) { + struct device_link *link = container_of(work, struct device_link, rm_work); + + /* Ensure that all references to the link object have been dropped. */ + device_link_synchronize_removal(); + while (refcount_dec_not_one(&link->rpm_active)) pm_runtime_put(link->supplier); @@ -454,24 +468,19 @@ static void device_link_free(struct devi kfree(link); } -#ifdef CONFIG_SRCU -static void __device_link_free_srcu(struct rcu_head *rhead) -{ - device_link_free(container_of(rhead, struct device_link, rcu_head)); -} - static void devlink_dev_release(struct device *dev) { struct device_link *link = to_devlink(dev); - call_srcu(&device_links_srcu, &link->rcu_head, __device_link_free_srcu); -} -#else -static void devlink_dev_release(struct device *dev) -{ - device_link_free(to_devlink(dev)); + INIT_WORK(&link->rm_work, device_link_release_fn); + /* + * It may take a while to complete this work because of the SRCU + * synchronization in device_link_release_fn() and if the consumer or + * supplier devices get deleted when it runs, so put it into the "long" + * workqueue. + */ + queue_work(system_long_wq, &link->rm_work); } -#endif static struct class devlink_class = { .name = "devlink", Index: linux-pm/include/linux/device.h =================================================================== --- linux-pm.orig/include/linux/device.h +++ linux-pm/include/linux/device.h @@ -570,7 +570,7 @@ struct device { * @flags: Link flags. * @rpm_active: Whether or not the consumer device is runtime-PM-active. * @kref: Count repeated addition of the same link. - * @rcu_head: An RCU head to use for deferred execution of SRCU callbacks. + * @rm_work: Work structure used for removing the link. * @supplier_preactivated: Supplier has been made active before consumer probe. */ struct device_link { @@ -583,9 +583,7 @@ struct device_link { u32 flags; refcount_t rpm_active; struct kref kref; -#ifdef CONFIG_SRCU - struct rcu_head rcu_head; -#endif + struct work_struct rm_work; bool supplier_preactivated; /* Owned by consumer probe. */ };