Received: by 2002:a05:6a10:87d6:0:0:0:0 with SMTP id g22csp331675pxr; Sun, 10 Apr 2022 16:31:48 -0700 (PDT) X-Google-Smtp-Source: ABdhPJyg3ah6MshHGdDzmVN37kM9OllKIwLurzpfy5WL3V2KluHRe7xvjVXMpsLJlC6VxUm2vnNs X-Received: by 2002:a50:c099:0:b0:415:f5c7:700e with SMTP id k25-20020a50c099000000b00415f5c7700emr30472980edf.205.1649633508663; Sun, 10 Apr 2022 16:31:48 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1649633508; cv=none; d=google.com; s=arc-20160816; b=LT+I94KhkqPLjxk9wBISHlqqdfyyt7+JX6vMjOGg3VBvXCG94pJyee2ON7SHy4ehQL 4liS33VVADDPKcz4grAREWEUnVYKxEWXWdEpRm1PDc8ofJhcEKz+oJ5hoCI98EynTyhd GGLaLMaXOBPRDi45lzfDNSpSsUjkiCijaSd2IYEHha9yrBQHPVKo8amAT+RsEZb2C4fm MHuUDJQEtgli1sj7bI4iGT4p+Mlt1kQoq+W3/SYgYPmpxUyzN4nrowI/jfK0alQW7GaO BHG2ZctOB+NmJihWS2HeFjmQockq6FFf1YcOZsT+YwxAW5VZKFPm8s5ptDclRHRVz2+H nd7A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=R6IbuxFpfDVMhDncVsiHX60lptQOTWXSO8DWlnPVzFw=; b=U1noe2OhPpg4CelNwCTZxGRlUToxq62EBdhtGVZT1I+CEe5GXzh2YlbBptOsbh7zOc 38h1I6BAqv4/L8ok6EFZrBwI6xxaOJFKhmPy14hhpYnOuQ0MxOdFpkNCyxhfS9cSiL9b kyjVDnI3t5TNGVx8f6PgEIGgYYgcijLyk6Yrd/0hlQuLq6aayDRa3VSa+RFyrk9MDFBu 7eJoUfllY/Iuw44kWBb6RRGqFPLHtxtThxpxV5KaNXh9hEDRtbFCQYhOLMAJ41Ve8OAT V+44kOiV4PhmF7iUyvsG3kDnOKqT513E7cC3e6uB/gz8DGUuNhjnT0meMrGROwxIrQWX gf4Q== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id v15-20020a17090606cf00b006df76385c7dsi1273788ejb.285.2022.04.10.16.31.24; Sun, 10 Apr 2022 16:31:48 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S242151AbiDINbQ (ORCPT + 99 others); Sat, 9 Apr 2022 09:31:16 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:56570 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S242111AbiDINbH (ORCPT ); Sat, 9 Apr 2022 09:31:07 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 1FA809AE6C; Sat, 9 Apr 2022 06:28:58 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 2d06ce431da4cb50; Sat, 9 Apr 2022 15:28:57 +0200 Received: from kreacher.localnet (89-77-51-84.dynamic.chello.pl [89.77.51.84]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id D266366BCD0; Sat, 9 Apr 2022 15:28:56 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PCI Cc: Linux PM , LKML , Bjorn Helgaas , Mika Westerberg Subject: [PATCH v1 4/7] PCI/PM: Rework changing power states of PCI devices Date: Sat, 09 Apr 2022 15:22:54 +0200 Message-ID: <3689460.kQq0lBPeGt@kreacher> In-Reply-To: <4419002.LvFx2qVVIh@kreacher> References: <4419002.LvFx2qVVIh@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 89.77.51.84 X-CLIENT-HOSTNAME: 89-77-51-84.dynamic.chello.pl X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvvddrudekvddgfeelucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvjeelgffhiedukedtleekkedvudfggefhgfegjefgueekjeelvefggfdvledutdenucfkphepkeelrdejjedrhedurdekgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeekledrjeejrdehuddrkeegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheplhhinhhugidqphgtihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehhvghlghgrrghssehkvghrnhgvlhdrohhrghdprhgtphhtthhopehmihhkrgdrfigvshht vghrsggvrhhgsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS,T_SCC_BODY_TEXT_LINE autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org From: Rafael J. Wysocki There are some issues related to changing power states of PCI devices, mostly related to carrying out unnecessary actions in some places, and the code is generally hard to follow. 1. pci_power_up() has two callers, pci_set_power_state() and pci_pm_default_resume_early(). The latter updates the current power state of the device right after calling pci_power_up() and it restores the entire config space of the device right after that, so pci_power_up() itself need not read the PCI_PM_CTRL register or restore the BARs after programming the device into D0 in that case (which it does currently). 2. It is generally hard to get a clear view of the pci_power_up() code flow, especially in some corner cases, due to all of the involved PCI_PM_CTRL register reads and writes occurring in pci_platform_power_transition() and in pci_raw_set_power_state(), some of which are redundant. 3. The transitions from low-power states to D0 and the other way around are unnecessarily tangled in pci_raw_set_power_state() which causes it to use a redundant local variable and makes the code in it rather hard to follow. To address the above shortcomings, make the following changes: a. Remove the code handling transitions into D0 from pci_raw_set_power_state() and rename that function as pci_set_low_power_state(). b. Add the code handling transitions into D0 directly to pci_power_up() and to a new function pci_set_full_power_state() calling it internally that is only used in pci_set_power_state(). c. Make pci_power_up() avoid redundant PCI_PM_CTRL register accesses and make it work in the same way for transitions from any low- power states (transitions from D1 and D2 are handled slightly differently, which is not really necessary, before the change). d. Put the restoration of the BARs and the PCI_PM_CTRL register read confirming the power state change into pci_set_full_power_state() to avoid doing these things in pci_pm_default_resume_early() in vain. Signed-off-by: Rafael J. Wysocki --- drivers/pci/pci.c | 145 +++++++++++++++++++++++++++++++++++++----------------- 1 file changed, 100 insertions(+), 45 deletions(-) Index: linux-pm/drivers/pci/pci.c =================================================================== --- linux-pm.orig/drivers/pci/pci.c +++ linux-pm/drivers/pci/pci.c @@ -1068,10 +1068,9 @@ static inline bool platform_pci_bridge_d } /** - * pci_raw_set_power_state - Use PCI PM registers to set the power state of - * given PCI device + * pci_set_low_power_state - Program the given device into a low-power state * @dev: PCI device to handle. - * @state: PCI power state (D0, D1, D2, D3hot) to put the device into. + * @state: PCI power state (D1, D2, D3hot) to put the device into. * * RETURN VALUE: * -EINVAL if the requested state is invalid. @@ -1080,10 +1079,9 @@ static inline bool platform_pci_bridge_d * 0 if device already is in the requested state. * 0 if device's power state has been successfully changed. */ -static int pci_raw_set_power_state(struct pci_dev *dev, pci_power_t state) +static int pci_set_low_power_state(struct pci_dev *dev, pci_power_t state) { u16 pmcsr; - bool need_restore = false; /* Check if we're already there */ if (dev->current_state == state) @@ -1092,7 +1090,7 @@ static int pci_raw_set_power_state(struc if (!dev->pm_cap) return -EIO; - if (state < PCI_D0 || state > PCI_D3hot) + if (state < PCI_D1 || state > PCI_D3hot) return -EINVAL; /* @@ -1101,8 +1099,7 @@ static int pci_raw_set_power_state(struc * we can go from D1 to D3, but we can't go directly from D3 to D1; * we'd have to go from D3 to D0, then to D1. */ - if (state != PCI_D0 && dev->current_state <= PCI_D3cold - && dev->current_state > state) { + if (dev->current_state <= PCI_D3cold && dev->current_state > state) { pci_err(dev, "invalid power transition (from %s to %s)\n", pci_power_name(dev->current_state), pci_power_name(state)); @@ -1127,23 +1124,9 @@ static int pci_raw_set_power_state(struc * This doesn't affect PME_Status, disables PME_En, and * sets PowerState to 0. */ - switch (dev->current_state) { - case PCI_D0: - case PCI_D1: - case PCI_D2: + if (dev->current_state <= PCI_D2) { pmcsr &= ~PCI_PM_CTRL_STATE_MASK; pmcsr |= state; - break; - case PCI_D3hot: - case PCI_D3cold: - case PCI_UNKNOWN: /* Boot-up */ - if ((pmcsr & PCI_PM_CTRL_STATE_MASK) == PCI_D3hot - && !(pmcsr & PCI_PM_CTRL_NO_SOFT_RESET)) - need_restore = true; - fallthrough; /* force to D0 */ - default: - pmcsr = 0; - break; } /* Enter specified state */ @@ -1153,9 +1136,9 @@ static int pci_raw_set_power_state(struc * Mandatory power management transition delays; see PCI PM 1.1 * 5.6.1 table 18 */ - if (state == PCI_D3hot || dev->current_state == PCI_D3hot) + if (state == PCI_D3hot) pci_dev_d3_sleep(dev); - else if (state == PCI_D2 || dev->current_state == PCI_D2) + else if (state == PCI_D2) udelay(PCI_PM_D2_DELAY); pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); @@ -1165,22 +1148,6 @@ static int pci_raw_set_power_state(struc pci_power_name(dev->current_state), pci_power_name(state)); - /* - * According to section 5.4.1 of the "PCI BUS POWER MANAGEMENT - * INTERFACE SPECIFICATION, REV. 1.2", a device transitioning - * from D3hot to D0 _may_ perform an internal reset, thereby - * going to "D0 Uninitialized" rather than "D0 Initialized". - * For example, at least some versions of the 3c905B and the - * 3c556B exhibit this behaviour. - * - * At least some laptop BIOSen (e.g. the Thinkpad T21) leave - * devices in a D3hot state at boot. Consequently, we need to - * restore at least the BARs so that the device will be - * accessible to its driver. - */ - if (need_restore) - pci_restore_bars(dev); - if (dev->bus->self) pcie_aspm_pm_state_change(dev->bus->self); @@ -1312,8 +1279,54 @@ static int pci_dev_wait(struct pci_dev * */ int pci_power_up(struct pci_dev *dev) { - pci_platform_power_transition(dev, PCI_D0); - return pci_raw_set_power_state(dev, PCI_D0); + int ret; + + ret = pci_platform_power_transition(dev, PCI_D0); + if (ret) { + u16 pmcsr; + + /* + * The PCI_PM_CTRL register has not been read above, so read it + * now and bail out if that fails. + */ + pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); + if (PCI_POSSIBLE_ERROR(pmcsr)) { + dev->current_state = PCI_D3cold; + goto fail; + } + dev->current_state = pmcsr & PCI_PM_CTRL_STATE_MASK; + } else if (dev->current_state == PCI_D3cold) { + /* + * Since current_state is still PCI_D3cold, the power state seen + * by the platform is still D3cold or the PCI_PM_CTRL register + * read in pci_update_current_state() has failed, so assume the + * device to be inaccessible. + */ + goto fail; + } + + /* There's nothing more to do if current_state is D0 at this point. */ + if (dev->current_state == PCI_D0) + return 0; + + /* + * Program the device into PCI_D0 by forcing the entire word to 0 (this + * doesn't affect PME_Status, disables PME_En, and sets PowerState to 0) + * and wait for the prescribed amount of time. Assume success. + */ + pci_write_config_word(dev, dev->pm_cap + PCI_PM_CTRL, 0); + + if (dev->current_state == PCI_D3hot) + pci_dev_d3_sleep(dev); + else if (dev->current_state == PCI_D2) + udelay(PCI_PM_D2_DELAY); + + dev->current_state = PCI_D0; + return 0; + +fail: + pci_err(dev, "Unable to change power state to D0, device inaccessible\n"); + return -ENODEV; } /** @@ -1340,6 +1353,48 @@ void pci_bus_set_current_state(struct pc pci_walk_bus(bus, __pci_dev_set_current_state, &state); } +static int pci_set_full_power_state(struct pci_dev *dev) +{ + pci_power_t old_state = dev->current_state; + u16 pmcsr; + int ret; + + ret = pci_power_up(dev); + if (ret) + return ret; + + if (!dev->pm_cap) + return 0; + + pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); + + dev->current_state = pmcsr & PCI_PM_CTRL_STATE_MASK; + if (dev->current_state != PCI_D0) { + pci_info_ratelimited(dev, "Refused to change power state from %s to D0\n", + pci_power_name(dev->current_state)); + } else if (old_state >= PCI_D3hot && !(pmcsr & PCI_PM_CTRL_NO_SOFT_RESET)) { + /* + * According to section 5.4.1 of the "PCI BUS POWER MANAGEMENT + * INTERFACE SPECIFICATION, REV. 1.2", a device transitioning + * from D3hot to D0 _may_ perform an internal reset, thereby + * going to "D0 Uninitialized" rather than "D0 Initialized". For + * example, at least some versions of the 3c905B and the 3c556B + * exhibit this behaviour. + * + * At least some laptop BIOSen (e.g. the Thinkpad T21) leave + * devices in a D3hot state at boot. Consequently, we need to + * restore at least the BARs so that the device will be + * accessible to its driver. + */ + pci_restore_bars(dev); + } + + if (dev->bus->self) + pcie_aspm_pm_state_change(dev->bus->self); + + return 0; +} + /** * pci_set_power_state - Set the power state of a PCI device * @dev: PCI device to handle. @@ -1381,7 +1436,7 @@ int pci_set_power_state(struct pci_dev * return 0; if (state == PCI_D0) - return pci_power_up(dev); + return pci_set_full_power_state(dev); /* * This device is quirked not to be put into D3, so don't put it in @@ -1394,7 +1449,7 @@ int pci_set_power_state(struct pci_dev * * To put device in D3cold, we put device into D3hot in native * way, then put device into D3cold with platform ops */ - error = pci_raw_set_power_state(dev, state > PCI_D3hot ? + error = pci_set_low_power_state(dev, state > PCI_D3hot ? PCI_D3hot : state); if (pci_platform_power_transition(dev, state))