Received: by 2002:a05:6512:3d0e:0:0:0:0 with SMTP id d14csp40140lfv; Tue, 12 Apr 2022 16:24:24 -0700 (PDT) X-Google-Smtp-Source: ABdhPJz/KQVRVqNU7gQTYLbJnP0jc9wG1GFfnkh6eEWPYEgY/PL+bRXo199hqYkIn6h37UDV0H81 X-Received: by 2002:a63:d30e:0:b0:39d:ade9:ab0d with SMTP id b14-20020a63d30e000000b0039dade9ab0dmr1165991pgg.51.1649805863813; Tue, 12 Apr 2022 16:24:23 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1649805863; cv=none; d=google.com; s=arc-20160816; b=TB7JoqqDmxDTnLS6TJ76BN6gqgmF2mnv8OfQHSRQOVPuWjuNXGFhiCBlK+2SXU+eeF J7U4bcRUXpEPRy4Gy4pwmdxKyWOeUXOEivRj+o2u+xGlAYG0S0dS4KddQYngdS+a19Ui 4PhzqD6lvKeJZl5k+zNOIm0JanPqnrcAKxOFYLVUnt7rpOSKmxC6Z1GHDm7Q3PcK0f4S kmp655YglveqTNmZnahSxN9eOio84Fp8U0f12S8zgSD6ph7cXPV2BA0IyZYttjrXb/Po bvUiNsEI2ayo9QeLOFEXYYST8/HakiwpKV9QT0GaAAhGyx2jbmd7idbi0unygQUvrJFb ajEA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=MU3HTrTB1xQc9tIcoIr/HYQ7ko1akIIMWKoO4Lg3JNA=; b=aW3zvXaHi47/Ds3u6ykBlBUfePmsfXtPO5WgQD+AXaY7yGdrcA/ORsmVvDDVnZ93Yx Xim/cDMIeLiuxV3M4WXFW4p6BLhvBdICtNDiBGsdEPJWPHz3UiJmJyD1ZuOCRiiFDW8p X+fMNJSS1qDpniOP1rQlQSOGliEdRqjCXsdirF7r7PnqYpSdtL7BSqX6DE3PgNc2SunO FTzG9wCwmSxtHpzYUtgkM0bEoh6lyKjwwdtELFjHJ/JApHp904h7e5qVR7zeVlxvcw2o Ml4fdqAZMm1NAgbHfsyVFbSYO5l84ON11x9jdsgPXzQvHAF0BF81e85VUUb7HZmZ0Otc jOxQ== ARC-Authentication-Results: i=1; mx.google.com; spf=softfail (google.com: domain of transitioning linux-kernel-owner@vger.kernel.org does not designate 23.128.96.19 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from lindbergh.monkeyblade.net (lindbergh.monkeyblade.net. [23.128.96.19]) by mx.google.com with ESMTPS id j27-20020a634a5b000000b0039c154f8c19si3775758pgl.835.2022.04.12.16.24.23 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 12 Apr 2022 16:24:23 -0700 (PDT) Received-SPF: softfail (google.com: domain of transitioning linux-kernel-owner@vger.kernel.org does not designate 23.128.96.19 as permitted sender) client-ip=23.128.96.19; Authentication-Results: mx.google.com; spf=softfail (google.com: domain of transitioning linux-kernel-owner@vger.kernel.org does not designate 23.128.96.19 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from vger.kernel.org (vger.kernel.org [23.128.96.18]) by lindbergh.monkeyblade.net (Postfix) with ESMTP id B26831A5D4C; Tue, 12 Apr 2022 14:17:07 -0700 (PDT) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S245174AbiDKOgt (ORCPT + 99 others); Mon, 11 Apr 2022 10:36:49 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:42970 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S1347350AbiDKOgk (ORCPT ); Mon, 11 Apr 2022 10:36:40 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 8277FE03; Mon, 11 Apr 2022 07:34:08 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id cc37e82fedf01ebf; Mon, 11 Apr 2022 16:34:06 +0200 Received: from kreacher.localnet (unknown [213.134.175.113]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 1F6C666BDED; Mon, 11 Apr 2022 16:34:05 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PCI Cc: Linux PM , LKML , Bjorn Helgaas , Mika Westerberg Subject: [PATCH v2 5/9] PCI/PM: Move pci_set_low_power_state() next to its caller Date: Mon, 11 Apr 2022 16:27:05 +0200 Message-ID: <3181973.aeNJFYEL58@kreacher> In-Reply-To: <11975904.O9o76ZdvQC@kreacher> References: <4419002.LvFx2qVVIh@kreacher> <11975904.O9o76ZdvQC@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.175.113 X-CLIENT-HOSTNAME: 213.134.175.113 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvvddrudekiedgjeekucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvffufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvjeelgffhiedukedtleekkedvudfggefhgfegjefgueekjeelvefggfdvledutdenucfkphepvddufedrudefgedrudejhedruddufeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddujeehrdduudefpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheplhhinhhugidqphgtihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehhvghlghgrrghssehkvghrnhgvlhdrohhrghdprhgtphhtthhopehm ihhkrgdrfigvshhtvghrsggvrhhgsehlihhnuhigrdhinhhtvghlrdgtohhm X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00, HEADER_FROM_DIFFERENT_DOMAINS,MAILING_LIST_MULTI,RDNS_NONE, SPF_HELO_NONE,T_SCC_BODY_TEXT_LINE autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org From: Rafael J. Wysocki Because pci_set_power_state() is the only caller of pci_set_low_power_state(), move the latter next to the former. No functional impact. Signed-off-by: Rafael J. Wysocki --- v1 -> v2: * Take v1 -> v2 difference in the previous patch into account. --- drivers/pci/pci.c | 160 +++++++++++++++++++++++++++--------------------------- 1 file changed, 80 insertions(+), 80 deletions(-) Index: linux-pm/drivers/pci/pci.c =================================================================== --- linux-pm.orig/drivers/pci/pci.c +++ linux-pm/drivers/pci/pci.c @@ -1068,86 +1068,6 @@ static inline bool platform_pci_bridge_d } /** - * pci_set_low_power_state - Program the given device into a low-power state - * @dev: PCI device to handle. - * @state: PCI power state (D1, D2, D3hot) to put the device into. - * - * RETURN VALUE: - * -EINVAL if the requested state is invalid. - * -EIO if device does not support PCI PM or its PM capabilities register has a - * wrong version, or device doesn't support the requested state. - * 0 if device already is in the requested state. - * 0 if device's power state has been successfully changed. - */ -static int pci_set_low_power_state(struct pci_dev *dev, pci_power_t state) -{ - u16 pmcsr; - - /* Check if we're already there */ - if (dev->current_state == state) - return 0; - - if (!dev->pm_cap) - return -EIO; - - if (state < PCI_D1 || state > PCI_D3hot) - return -EINVAL; - - /* - * Validate transition: We can enter D0 from any state, but if - * we're already in a low-power state, we can only go deeper. E.g., - * we can go from D1 to D3, but we can't go directly from D3 to D1; - * we'd have to go from D3 to D0, then to D1. - */ - if (dev->current_state <= PCI_D3cold && dev->current_state > state) { - pci_err(dev, "invalid power transition (from %s to %s)\n", - pci_power_name(dev->current_state), - pci_power_name(state)); - return -EINVAL; - } - - /* Check if this device supports the desired state */ - if ((state == PCI_D1 && !dev->d1_support) - || (state == PCI_D2 && !dev->d2_support)) - return -EIO; - - pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); - if (PCI_POSSIBLE_ERROR(pmcsr)) { - pci_err(dev, "can't change power state from %s to %s (config space inaccessible)\n", - pci_power_name(dev->current_state), - pci_power_name(state)); - return -EIO; - } - - pmcsr &= ~PCI_PM_CTRL_STATE_MASK; - pmcsr |= state; - - /* Enter specified state */ - pci_write_config_word(dev, dev->pm_cap + PCI_PM_CTRL, pmcsr); - - /* - * Mandatory power management transition delays; see PCI PM 1.1 - * 5.6.1 table 18 - */ - if (state == PCI_D3hot) - pci_dev_d3_sleep(dev); - else if (state == PCI_D2) - udelay(PCI_PM_D2_DELAY); - - pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); - dev->current_state = (pmcsr & PCI_PM_CTRL_STATE_MASK); - if (dev->current_state != state) - pci_info_ratelimited(dev, "refused to change power state from %s to %s\n", - pci_power_name(dev->current_state), - pci_power_name(state)); - - if (dev->bus->self) - pcie_aspm_pm_state_change(dev->bus->self); - - return 0; -} - -/** * pci_update_current_state - Read power state of given device and cache it * @dev: PCI device to handle. * @state: State to cache in case the device doesn't have the PM capability @@ -1384,6 +1304,86 @@ static int pci_set_full_power_state(stru if (dev->bus->self) pcie_aspm_pm_state_change(dev->bus->self); + + return 0; +} + +/** + * pci_set_low_power_state - Program the given device into a low-power state + * @dev: PCI device to handle. + * @state: PCI power state (D1, D2, D3hot) to put the device into. + * + * RETURN VALUE: + * -EINVAL if the requested state is invalid. + * -EIO if device does not support PCI PM or its PM capabilities register has a + * wrong version, or device doesn't support the requested state. + * 0 if device already is in the requested state. + * 0 if device's power state has been successfully changed. + */ +static int pci_set_low_power_state(struct pci_dev *dev, pci_power_t state) +{ + u16 pmcsr; + + /* Check if we're already there */ + if (dev->current_state == state) + return 0; + + if (!dev->pm_cap) + return -EIO; + + if (state < PCI_D1 || state > PCI_D3hot) + return -EINVAL; + + /* + * Validate transition: We can enter D0 from any state, but if + * we're already in a low-power state, we can only go deeper. E.g., + * we can go from D1 to D3, but we can't go directly from D3 to D1; + * we'd have to go from D3 to D0, then to D1. + */ + if (dev->current_state <= PCI_D3cold && dev->current_state > state) { + pci_err(dev, "invalid power transition (from %s to %s)\n", + pci_power_name(dev->current_state), + pci_power_name(state)); + return -EINVAL; + } + + /* Check if this device supports the desired state */ + if ((state == PCI_D1 && !dev->d1_support) + || (state == PCI_D2 && !dev->d2_support)) + return -EIO; + + pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); + if (PCI_POSSIBLE_ERROR(pmcsr)) { + pci_err(dev, "can't change power state from %s to %s (config space inaccessible)\n", + pci_power_name(dev->current_state), + pci_power_name(state)); + return -EIO; + } + + pmcsr &= ~PCI_PM_CTRL_STATE_MASK; + pmcsr |= state; + + /* Enter specified state */ + pci_write_config_word(dev, dev->pm_cap + PCI_PM_CTRL, pmcsr); + + /* + * Mandatory power management transition delays; see PCI PM 1.1 + * 5.6.1 table 18 + */ + if (state == PCI_D3hot) + pci_dev_d3_sleep(dev); + else if (state == PCI_D2) + udelay(PCI_PM_D2_DELAY); + + pci_read_config_word(dev, dev->pm_cap + PCI_PM_CTRL, &pmcsr); + dev->current_state = (pmcsr & PCI_PM_CTRL_STATE_MASK); + if (dev->current_state != state) + pci_info_ratelimited(dev, "refused to change power state from %s to %s\n", + pci_power_name(dev->current_state), + pci_power_name(state)); + + if (dev->bus->self) + pcie_aspm_pm_state_change(dev->bus->self); return 0; }