Received: by 2002:a05:6a10:6d10:0:0:0:0 with SMTP id gq16csp959101pxb; Fri, 22 Apr 2022 15:20:18 -0700 (PDT) X-Google-Smtp-Source: ABdhPJxOjpB3xchToN4FiLj6tO4WsNiGISVWpOwzp4y8qlkmKFAKHFSrCUCcBo85NC5Q1Q1Xm8lH X-Received: by 2002:a17:90a:1509:b0:1d8:c22b:4d61 with SMTP id l9-20020a17090a150900b001d8c22b4d61mr3548000pja.78.1650666018114; Fri, 22 Apr 2022 15:20:18 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1650666018; cv=none; d=google.com; s=arc-20160816; b=vxWavOOenKwzbhcofXoDfJdir7Kuad7Td7Vso42Uqge49A/ID1R7c9Lo3qlFjm91BW Um9QZBbsfsHxfWoDxR5epLHcG5DIuFcMJcOZD4dyCVp1qKR6QQsNW064yV3VnWQpPPv7 IlItB+l9bS0QA4yRfY9vAj6XcnViOkqqnT/nZsqBQWmt7uH+f5mwKB+hE5hH8vebTfYm TNTOAa2NM3LJgvRioW1X38xJXs/sxK0bLOEn0oYIkANWuqf/8sg0RaR1MNn+qS1pFK4E qsRpgIh0/HXRETO0QLDyTSTsDtbatBh4IVHoCXwJZkJf0vDZQAWlfzwB6x6eO8sm3DS5 K41Q== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:in-reply-to:content-disposition:mime-version :references:message-id:subject:cc:to:from:date:dkim-signature; bh=B+l4XElmjbgWuxsFxm95+PlAoY+lFpSuxuxo0rKhTgE=; b=wQbx7zwj8MAhBOyengMXEBPwAJ1zleTWbLMUt5Rq0LBXVgYh1fhy6CWhEShG3BzCef Wz5ghwgdzf7oiFeEs9gFNHb1JRu2wUnSG9likr/OhXEcUdfmMV3wkBewL1G2R12hpvE+ qg6qqCr4ILjub3EXol+GD95onoJVJdj+g3a+a66yAOuVY1anjGv8Ndtgc2eP0xSO7R0K RoJAi60gT/MIn2eKhWD0obEMCT7itHagKlIyy3DqZnDwgOyr3/nYq7oN4O++iFtk/pTl Uq0vsQrkEaB2/CmZTVxW4R4pmbvEuMnx5fqPGTDwKKLdoE3qUXFHTcrZJxxD9gOUNHVP SLVg== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@gmail.com header.s=20210112 header.b=gBqOzKxD; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org; dmarc=pass (p=NONE sp=QUARANTINE dis=NONE) header.from=gmail.com Return-Path: Received: from lindbergh.monkeyblade.net (lindbergh.monkeyblade.net. [2620:137:e000::1:18]) by mx.google.com with ESMTPS id n12-20020a170902f60c00b0015448e01af7si9859816plg.96.2022.04.22.15.20.17 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Fri, 22 Apr 2022 15:20:18 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:18 as permitted sender) client-ip=2620:137:e000::1:18; Authentication-Results: mx.google.com; dkim=pass header.i=@gmail.com header.s=20210112 header.b=gBqOzKxD; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:18 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org; dmarc=pass (p=NONE sp=QUARANTINE dis=NONE) header.from=gmail.com Received: from out1.vger.email (out1.vger.email [IPv6:2620:137:e000::1:20]) by lindbergh.monkeyblade.net (Postfix) with ESMTP id 799EE3C2768; Fri, 22 Apr 2022 13:25:50 -0700 (PDT) Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1352744AbiDVDOR (ORCPT + 99 others); Thu, 21 Apr 2022 23:14:17 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:58928 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S242102AbiDVDOP (ORCPT ); Thu, 21 Apr 2022 23:14:15 -0400 Received: from mail-qt1-x835.google.com (mail-qt1-x835.google.com [IPv6:2607:f8b0:4864:20::835]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id DBAC14CD59; Thu, 21 Apr 2022 20:11:22 -0700 (PDT) Received: by mail-qt1-x835.google.com with SMTP id d14so4698109qtw.5; Thu, 21 Apr 2022 20:11:22 -0700 (PDT) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gmail.com; s=20210112; h=date:from:to:cc:subject:message-id:references:mime-version :content-disposition:in-reply-to; bh=B+l4XElmjbgWuxsFxm95+PlAoY+lFpSuxuxo0rKhTgE=; b=gBqOzKxDrbfKga/SiNfyIJuZe8Nl5IMEUtFjjUUynK0ykrPF2JEbcju4SvM1kv0uY9 RYx7+lzLWijIqblQ5l2ikg0xFW/QAIi/nlrtMj5T3F7Uv++i0AtySWtD2RCYSQx1sput Dx+aOFRyS+pSJpVkL14nB6K12a7sJwNUDjIMCYpzSe/XdB7uDpNDHsKCELyZshW3XC8h A9h3vcTpCn7MWWpQE1R9SR9bwYMyn9hT/Tasea3gOymeWCLv8q8+k2RcgNmxu8/0Jmmi pFP5V26L8Qs5ELuW6E3J7LuUzxrduQh5JNTLvuUHNQt64lBa0bhBTfIuxFG9ApkrdHZs i7Jg== X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=1e100.net; s=20210112; h=x-gm-message-state:date:from:to:cc:subject:message-id:references :mime-version:content-disposition:in-reply-to; bh=B+l4XElmjbgWuxsFxm95+PlAoY+lFpSuxuxo0rKhTgE=; b=WI9xzr75tv0fgLJP6j/ik0FM+ITVWvfo92/x8EQUUEVPi5jf9xCr9JdAvqCBx8gS9L fp78XpUGm6DGq6DCAbAYR3ZQNvoL5HFTS4v6YZJtlkB0sgndBlwksYJkzQvwKPBM9l+9 Map3GcmGhLDQClFIu9eLagN93LFlInZa2N3Rs3u3PkZaH3cJyHOH681DtroJD48KFl6o 17beWFAJUduYtkdk6CJajxRGxl39KH0UF9iTwMwVQCA9lGcU6ApSEnwAOe0N0eCjmv30 Ct1ZPq7lzyIiHcWhhzKh5a8axjZJN9xE7Q470Xo4F0LAFzDMLFi0wXjrmmlwj8ljWEzD Go5A== X-Gm-Message-State: AOAM531kGBEjEFaFe+LknW+0bovY52nLvZ5J6aZFT1idXT9dzVvZWdcu BTD1LsmWDgjv5tIPPrmNllM= X-Received: by 2002:ac8:59d0:0:b0:2f1:fc58:2fce with SMTP id f16-20020ac859d0000000b002f1fc582fcemr1823753qtf.290.1650597081984; Thu, 21 Apr 2022 20:11:21 -0700 (PDT) Received: from auth1-smtp.messagingengine.com (auth1-smtp.messagingengine.com. [66.111.4.227]) by smtp.gmail.com with ESMTPSA id 15-20020ac8594f000000b002f200ea2518sm540355qtz.59.2022.04.21.20.11.20 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Thu, 21 Apr 2022 20:11:20 -0700 (PDT) Received: from compute4.internal (compute4.nyi.internal [10.202.2.44]) by mailauth.nyi.internal (Postfix) with ESMTP id C3A1227C0054; Thu, 21 Apr 2022 23:11:19 -0400 (EDT) Received: from mailfrontend2 ([10.202.2.163]) by compute4.internal (MEProxy); Thu, 21 Apr 2022 23:11:19 -0400 X-ME-Sender: X-ME-Received: X-ME-Proxy-Cause: gggruggvucftvghtrhhoucdtuddrgedvfedrtdefgdeijecutefuodetggdotefrodftvf curfhrohhfihhlvgemucfhrghsthforghilhdpqfgfvfdpuffrtefokffrpgfnqfghnecu uegrihhlohhuthemuceftddtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenuc fjughrpeffhffvvefukfhfgggtuggjsehgtderredttddvnecuhfhrohhmpeeuohhquhhn ucfhvghnghcuoegsohhquhhnrdhfvghnghesghhmrghilhdrtghomheqnecuggftrfgrth htvghrnhepvdekhfduveeitdehueehfeekgfduhfetvdefhffhteejhfelvddtgefftddu feffnecuffhomhgrihhnpehthhgvrdgrqhdpkhgvrhhnvghlrdhorhhgnecuvehluhhsth gvrhfuihiivgeptdenucfrrghrrghmpehmrghilhhfrhhomhepsghoqhhunhdomhgvshhm thhprghuthhhphgvrhhsohhnrghlihhthidqieelvdeghedtieegqddujeejkeehheehvd dqsghoqhhunhdrfhgvnhhgpeepghhmrghilhdrtghomhesfhhigihmvgdrnhgrmhgv X-ME-Proxy: Received: by mail.messagingengine.com (Postfix) with ESMTPA; Thu, 21 Apr 2022 23:11:16 -0400 (EDT) Date: Fri, 22 Apr 2022 11:11:04 +0800 From: Boqun Feng To: Guo Ren Cc: Dan Lustig , Andrea Parri , "Paul E. McKenney" , Arnd Bergmann , Palmer Dabbelt , Mark Rutland , Will Deacon , Peter Zijlstra , linux-arch , Linux Kernel Mailing List , linux-riscv , Guo Ren Subject: Re: [PATCH V2 0/3] riscv: atomic: Optimize AMO instructions usage Message-ID: References: <3f7dd397-2ccd-dfa3-a0ec-dcce6cbc0476@nvidia.com> <41e01514-74ca-84f2-f5cc-2645c444fd8e@nvidia.com> MIME-Version: 1.0 Content-Type: multipart/signed; micalg=pgp-sha256; protocol="application/pgp-signature"; boundary="rFNHEmSRQ446Sd/1" Content-Disposition: inline In-Reply-To: X-Spam-Status: No, score=-1.7 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,DKIM_VALID_AU,FREEMAIL_FORGED_FROMDOMAIN,FREEMAIL_FROM, HEADER_FROM_DIFFERENT_DOMAINS,MAILING_LIST_MULTI,RDNS_NONE, SPF_HELO_NONE autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org --rFNHEmSRQ446Sd/1 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline Content-Transfer-Encoding: quoted-printable On Fri, Apr 22, 2022 at 09:56:21AM +0800, Guo Ren wrote: > On Fri, Apr 22, 2022 at 6:56 AM Boqun Feng wrote: > > > > On Thu, Apr 21, 2022 at 05:39:09PM +0800, Guo Ren wrote: > > > Hi Dan, > > > > > > On Thu, Apr 21, 2022 at 1:03 AM Dan Lustig wrote: > > > > > > > > On 4/20/2022 1:33 AM, Guo Ren wrote: > > > > > Thx Dan, > > > > > > > > > > On Wed, Apr 20, 2022 at 1:12 AM Dan Lustig w= rote: > > > > >> > > > > >> On 4/17/2022 12:51 AM, Guo Ren wrote: > > > > >>> Hi Boqun & Andrea, > > > > >>> > > > > >>> On Sun, Apr 17, 2022 at 10:26 AM Boqun Feng wrote: > > > > >>>> > > > > >>>> On Sun, Apr 17, 2022 at 12:49:44AM +0800, Guo Ren wrote: > > > > >>>> [...] > > > > >>>>> > > > > >>>>> If both the aq and rl bits are set, the atomic memory operati= on is > > > > >>>>> sequentially consistent and cannot be observed to happen befo= re any > > > > >>>>> earlier memory operations or after any later memory operation= s in the > > > > >>>>> same RISC-V hart and to the same address domain. > > > > >>>>> "0: lr.w %[p], %[c]\n" > > > > >>>>> " sub %[rc], %[p], %[o]\n" > > > > >>>>> " bltz %[rc], 1f\n". > > > > >>>>> - " sc.w.rl %[rc], %[rc], %[c]\n" > > > > >>>>> + " sc.w.aqrl %[rc], %[rc], %[c]\n" > > > > >>>>> " bnez %[rc], 0b\n" > > > > >>>>> - " fence rw, rw\n" > > > > >>>>> "1:\n" > > > > >>>>> So .rl + fence rw, rw is over constraints, only using sc.w.aq= rl is more proper. > > > > >>>>> > > > > >>>> > > > > >>>> Can .aqrl order memory accesses before and after it (not again= st itself, > > > > >>>> against each other), i.e. act as a full memory barrier? For ex= ample, can > > > > >>> From the RVWMO spec description, the .aqrl annotation appends t= he same > > > > >>> effect with "fence rw, rw" to the AMO instruction, so it's RCsc. > > > > >>> > > > > >>> Not only .aqrl, and I think the below also could be an RCsc when > > > > >>> sc.w.aq is executed: > > > > >>> A: Pre-Access > > > > >>> B: lr.w.rl ADDR-0 > > > > >>> ... > > > > >>> C: sc.w.aq ADDR-0 > > > > >>> D: Post-Acess > > > > >>> Because sc.w.aq has overlap address & data dependency on lr.w.r= l, the > > > > >>> global memory order should be A->B->C->D when sc.w.aq is execut= ed. For > > > > >>> the amoswap > > > > >> > > > > >> These opcodes aren't actually meaningful, unfortunately. > > > > >> > > > > >> Quoting the ISA manual chapter 10.2: "Software should not set th= e rl bit > > > > >> on an LR instruction unless the aq bit is also set, nor should s= oftware > > > > >> set the aq bit on an SC instruction unless the rl bit is also se= t." > > > > > 1. Oh, I've missed the behind half of the ISA manual. But why can= 't we > > > > > utilize lr.rl & sc.aq in software programming to guarantee the > > > > > sequence? > > > > > > > > lr.aq and sc.rl map more naturally to hardware than lr.rl and sc.aq. > > > > Plus, they just aren't common operations to begin with, e.g., there > > > > is no smp_store_acquire() or smp_load_release(), nor are there > > > > equivalents in C/C++ atomics. > > > First, thx for pointing out that my patch violates the rules defined > > > in the ISA manual. I've abandoned these parts in v3. > > > > > > It's easy to let hw support lr.rl & sc.aq (eg: our hardware supports > > > them). I agree there are no equivalents in C/C++ atomics. But they are > > > useful for LR/SC pairs to implement atomic_acqurie/release semantics. > > > Compare below: > > > A): fence rw, r; lr > > > B): lr.rl > > > The A has another "fence ,r" effect in semantics, it's over commit > > > from a software design view. > > > > > > ps: Current definition has problems: > > > #define RISCV_ACQUIRE_BARRIER "\tfence r , rw\n" > > > #define RISCV_RELEASE_BARRIER "\tfence rw, w\n" > > > > > > #define __cmpxchg_release(ptr, old, new, size) = \ > > > ... > > > __asm__ __volatile__ ( = \ > > > RISCV_RELEASE_BARRIER = \ > > > "0: lr.w %0, %2\n" = \ > > > > > > That means "fence rw, w" can't prevent lr.w beyond the fence, we need > > > a "fence.rw. r" here. Here is the Fixup patch which I'm preparing: > > > > > > > That's not true. Note that RELEASE semantics only applies to the > > write/store part of a read-modify-write atomic, similarly, ACQUIRE only > I just want to point out that the "atomic" mentioned here is only for > RISC-V LR/SC AMO instructions. It has been clarified to tread AMO > instruction as the whole part for other AMO instructions. >=20 > - .aq: If the aq bit is set, then no later memory operations > in this RISC-V hart can be observed to take place > before the AMO. > - .rl: If the rl bit is set, then other RISC-V harts will not > observe the AMO before memory accesses preceding the > AMO in this RISC-V hart. > - .aqrl: Setting both the aq and the rl bit on an AMO makes the > sequence sequentially consistent, meaning that it cannot > be reordered with earlier or later memory operations > from the same hart. >=20 > > applies to the read/load part. For example, the following litmus test > > can observe the exists clause being true. > Thx for pointing out, that means changing "fence rw, w" to "fence rw. > r" is more strict and it would lower performance, right? Yes, I think it's more strict but honestly I don't know the performance impact ;-) >=20 > > > > {} > > > > P0(int *x, int *y) > > { > > int r0; > > int r1; > > > > r0 =3D cmpxchg_acquire(x, 0, 1); > > r1 =3D READ_ONCE(*y); > Oh, READ_ONCE could be beyond the write/store part of cmpxchg_acquire, > right? We shouldn't prevent it. Right, the reordering is allowed by the API of Linux atomics and you don't have to prevent it. Regards, Boqun >=20 > > } > > > > P1(int *x, int *y) > > { > > int r0; > > > > WRITE_ONCE(*y, 1); > > smp_mb(); > > r0 =3D READ_ONCE(*x); > > } > > > > exists (0:r0=3D0 /\ 0:r1=3D0 /\ 1:r0=3D0) > > > > Regards, > > Boqun > > > > > From 14c93aca0c3b10cf134791cf491b459972a36ec4 Mon Sep 17 00:00:00 2001 > > > From: Guo Ren > > > Date: Thu, 21 Apr 2022 16:44:48 +0800 > > > Subject: [PATCH] riscv: atomic: Fixup wrong __atomic_acquire/release_= fence > > > implementation > > > > > > Current RISCV_ACQUIRE/RELEASE_BARRIER is for spin_lock not atomic. > > > > > > __cmpxchg_release(ptr, old, new, size) > > > ... > > > __asm__ __volatile__ ( > > > RISCV_RELEASE_BARRIER > > > "0: lr.w %0, %2\n" > > > > > > The "fence rw, w -> lr.w" is invalid and lr would beyond fence, so > > > we need "fence rw, r -> lr.w" here. Atomic acquire is the same. > > > > > > Fixes: 0123f4d76ca6 ("riscv/spinlock: Strengthen implementations with= fences") > > > Signed-off-by: Guo Ren > > > Signed-off-by: Guo Ren > > > Cc: Palmer Dabbelt > > > Cc: Mark Rutland > > > Cc: Andrea Parri > > > Cc: Dan Lustig > > > Cc: stable@vger.kernel.org > > > --- > > > arch/riscv/include/asm/atomic.h | 4 ++-- > > > arch/riscv/include/asm/cmpxchg.h | 8 ++++---- > > > arch/riscv/include/asm/fence.h | 4 ++++ > > > 3 files changed, 10 insertions(+), 6 deletions(-) > > > > > > diff --git a/arch/riscv/include/asm/atomic.h b/arch/riscv/include/asm= /atomic.h > > > index aef8aa9ac4f4..7cd66eba6ec3 100644 > > > --- a/arch/riscv/include/asm/atomic.h > > > +++ b/arch/riscv/include/asm/atomic.h > > > @@ -20,10 +20,10 @@ > > > #include > > > > > > #define __atomic_acquire_fence() = \ > > > - __asm__ __volatile__(RISCV_ACQUIRE_BARRIER "" ::: "memory") > > > + __asm__ __volatile__(RISCV_ATOMIC_ACQUIRE_BARRIER "":::"memor= y") > > > > > > #define __atomic_release_fence() = \ > > > - __asm__ __volatile__(RISCV_RELEASE_BARRIER "" ::: "memory"); > > > + __asm__ __volatile__(RISCV_ATOMIC_RELEASE_BARRIER"" ::: "memo= ry"); > > > > > > static __always_inline int arch_atomic_read(const atomic_t *v) > > > { > > > diff --git a/arch/riscv/include/asm/cmpxchg.h b/arch/riscv/include/as= m/cmpxchg.h > > > index 9269fceb86e0..605edc2fca3b 100644 > > > --- a/arch/riscv/include/asm/cmpxchg.h > > > +++ b/arch/riscv/include/asm/cmpxchg.h > > > @@ -217,7 +217,7 @@ > > > " bne %0, %z3, 1f\n" = \ > > > " sc.w %1, %z4, %2\n" = \ > > > " bnez %1, 0b\n" = \ > > > - RISCV_ACQUIRE_BARRIER = \ > > > + RISCV_ATOMIC_ACQUIRE_BARRIER = \ > > > "1:\n" = \ > > > : "=3D&r" (__ret), "=3D&r" (__rc), "+A" (*__p= tr) \ > > > : "rJ" ((long)__old), "rJ" (__new) = \ > > > @@ -229,7 +229,7 @@ > > > " bne %0, %z3, 1f\n" = \ > > > " sc.d %1, %z4, %2\n" = \ > > > " bnez %1, 0b\n" = \ > > > - RISCV_ACQUIRE_BARRIER = \ > > > + RISCV_ATOMIC_ACQUIRE_BARRIER = \ > > > "1:\n" = \ > > > : "=3D&r" (__ret), "=3D&r" (__rc), "+A" (*__p= tr) \ > > > : "rJ" (__old), "rJ" (__new) = \ > > > @@ -259,7 +259,7 @@ > > > switch (size) { = \ > > > case 4: = \ > > > __asm__ __volatile__ ( = \ > > > - RISCV_RELEASE_BARRIER = \ > > > + RISCV_ATOMIC_RELEASE_BARRIER = \ > > > "0: lr.w %0, %2\n" = \ > > > " bne %0, %z3, 1f\n" = \ > > > " sc.w %1, %z4, %2\n" = \ > > > @@ -271,7 +271,7 @@ > > > break; = \ > > > case 8: = \ > > > __asm__ __volatile__ ( = \ > > > - RISCV_RELEASE_BARRIER = \ > > > + RISCV_ATOMIC_RELEASE_BARRIER = \ > > > "0: lr.d %0, %2\n" = \ > > > " bne %0, %z3, 1f\n" = \ > > > " sc.d %1, %z4, %2\n" = \ > > > diff --git a/arch/riscv/include/asm/fence.h b/arch/riscv/include/asm/= fence.h > > > index 2b443a3a487f..4e446d64f04f 100644 > > > --- a/arch/riscv/include/asm/fence.h > > > +++ b/arch/riscv/include/asm/fence.h > > > @@ -4,9 +4,13 @@ > > > #ifdef CONFIG_SMP > > > #define RISCV_ACQUIRE_BARRIER "\tfence r , rw\n" > > > #define RISCV_RELEASE_BARRIER "\tfence rw, w\n" > > > +#define RISCV_ATOMIC_ACQUIRE_BARRIER "\tfence w , rw\n" > > > +#define RISCV_ATOMIC_RELEASE_BARRIER "\tfence rw, r\n" > > > #else > > > #define RISCV_ACQUIRE_BARRIER > > > #define RISCV_RELEASE_BARRIER > > > +#define RISCV_ATOMIC_ACQUIRE_BARRIER > > > +#define RISCV_ATOMIC_RELEASE_BARRIER > > > #endif > > > > > > #endif /* _ASM_RISCV_FENCE_H */ > > > > > > > > > > > > > > > 2. Using .aqrl to replace the fence rw, rw is okay to ISA manual, > > > > > right? And reducing a fence instruction to gain better performanc= e: > > > > > "0: lr.w %[p], %[c]\n" > > > > > " sub %[rc], %[p], %[o]\n" > > > > > " bltz %[rc], 1f\n". > > > > > - " sc.w.rl %[rc], %[rc], %[c]\n" > > > > > + " sc.w.aqrl %[rc], %[rc], %[c]\n" > > > > > " bnez %[rc], 0b\n" > > > > > - " fence rw, rw\n" > > > > > > > > Yes, using .aqrl is valid. > > > Thx and I think the below is also valid, right? > > > > > > - RISCV_RELEASE_BARRIER = \ > > > - " amoswap.w %0, %2, %1\n" = \ > > > + " amoswap.w.rl %0, %2, %1\n" = \ > > > > > > - " amoswap.d %0, %2, %1\n" = \ > > > - RISCV_ACQUIRE_BARRIER = \ > > > + " amoswap.d.aq %0, %2, %1\n" = \ > > > > > > > > > > > Dan > > > > > > > > >> > > > > >> Dan > > > > >> > > > > >>> The purpose of the whole patchset is to reduce the usage of > > > > >>> independent fence rw, rw instructions, and maximize the usage o= f the > > > > >>> .aq/.rl/.aqrl aonntation of RISC-V. > > > > >>> > > > > >>> __asm__ __volatile__ ( = \ > > > > >>> "0: lr.w %0, %2\n" = \ > > > > >>> " bne %0, %z3, 1f\n" = \ > > > > >>> " sc.w.rl %1, %z4, %2\n" = \ > > > > >>> " bnez %1, 0b\n" = \ > > > > >>> " fence rw, rw\n" = \ > > > > >>> "1:\n" = \ > > > > >>> > > > > >>>> we end up with u =3D=3D 1, v =3D=3D 1, r1 on P0 is 0 and r1 on= P1 is 0, for the > > > > >>>> following litmus test? > > > > >>>> > > > > >>>> C lr-sc-aqrl-pair-vs-full-barrier > > > > >>>> > > > > >>>> {} > > > > >>>> > > > > >>>> P0(int *x, int *y, atomic_t *u) > > > > >>>> { > > > > >>>> int r0; > > > > >>>> int r1; > > > > >>>> > > > > >>>> WRITE_ONCE(*x, 1); > > > > >>>> r0 =3D atomic_cmpxchg(u, 0, 1); > > > > >>>> r1 =3D READ_ONCE(*y); > > > > >>>> } > > > > >>>> > > > > >>>> P1(int *x, int *y, atomic_t *v) > > > > >>>> { > > > > >>>> int r0; > > > > >>>> int r1; > > > > >>>> > > > > >>>> WRITE_ONCE(*y, 1); > > > > >>>> r0 =3D atomic_cmpxchg(v, 0, 1); > > > > >>>> r1 =3D READ_ONCE(*x); > > > > >>>> } > > > > >>>> > > > > >>>> exists (u=3D1 /\ v=3D1 /\ 0:r1=3D0 /\ 1:r1=3D0) > > > > >>> I think my patchset won't affect the above sequence guarantee. = Current > > > > >>> RISC-V implementation only gives RCsc when the original value i= s the > > > > >>> same at least once. So I prefer RISC-V cmpxchg should be: > > > > >>> > > > > >>> > > > > >>> - "0: lr.w %0, %2\n" = \ > > > > >>> + "0: lr.w.rl %0, %2\n" = \ > > > > >>> " bne %0, %z3, 1f\n" = \ > > > > >>> " sc.w.rl %1, %z4, %2\n" = \ > > > > >>> " bnez %1, 0b\n" = \ > > > > >>> - " fence rw, rw\n" = \ > > > > >>> "1:\n" = \ > > > > >>> + " fence w, rw\n" = \ > > > > >>> > > > > >>> To give an unconditional RSsc for atomic_cmpxchg. > > > > >>> > > > > >>>> > > > > >>>> Regards, > > > > >>>> Boqun > > > > >>> > > > > >>> > > > > >>> > > > > > > > > > > > > > > > > > > > > > > > > > > > -- > > > Best Regards > > > Guo Ren > > > > > > ML: https://lore.kernel.org/linux-csky/ >=20 >=20 >=20 > --=20 > Best Regards > Guo Ren >=20 > ML: https://lore.kernel.org/linux-csky/ --rFNHEmSRQ446Sd/1 Content-Type: application/pgp-signature; name="signature.asc" -----BEGIN PGP SIGNATURE----- iQEzBAABCAAdFiEEj5IosQTPz8XU1wRHSXnow7UH+rgFAmJiHMMACgkQSXnow7UH +rj20Qf+OggnPum9nhsiUtP9QYrFtFUxUddPq/Wk4p2iPJp+7z6/ERpjjgf7D2+l Mj1XBUG3mjUQHXCrWdannEr54sUji3cfmLMJLA8rIQEGXCf8Lkj0+rP2z4mm3X4L +BObGoOBepNjK0NjgnuDX6aF0q3SrZOMLPu0AhmgZsmHfxdw+biMkgBB+HkPM556 F9Z1KtoPdb5bFqLxRm34C/QLx2wH5WyEEnX98Dtl5EwbfzpR7Ya4Syr+hmG8CvSO opad0eDMpLTLcOVsvHlSdn5CzlAicRh6AnC38PK6eint8oVd4tvBvkGykOT/QKlB DyMksQ755yri5W5h60S0AwbUXLL45w== =lOW+ -----END PGP SIGNATURE----- --rFNHEmSRQ446Sd/1--