Received: by 2002:ac0:da4c:0:0:0:0:0 with SMTP id a12csp316673imi; Thu, 21 Jul 2022 01:05:10 -0700 (PDT) X-Google-Smtp-Source: AGRyM1tVj5jOEnJakfpk0x4jBgU4FbMwnc7WPyTLwVP/bRxAgt29s3shc+9qF7Oeblt3vIqRwL+N X-Received: by 2002:a17:906:c7c1:b0:711:d2e9:99d0 with SMTP id dc1-20020a170906c7c100b00711d2e999d0mr39286741ejb.639.1658390710418; Thu, 21 Jul 2022 01:05:10 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1658390710; cv=none; d=google.com; s=arc-20160816; b=wlUksoTzEwgZuFhiTcMSaFaa+buyek79IgQL3oNtmyRNjck6X5iI8SsAIw3CLeUzeG /Z75F2QoUdtxqAdgRX00pcNvbaKaszcZSyf7HJdKMhJAN3ZeZ4vG9VGDqYAWaiDrjKgD /6Re2y6+Xn2ZMm63mMLYimQjpz+waBfJyqmNbnmpW/nISDnpiHx/laZghPaXNabeH3Ur 5iRXBq71OMV60gADymublkPn+YXuE68HEBEB/zB2EsU7/3pI5TRnbGwDdNSX+hA02pHy oEXRI9wdFtRbmLXxzyvhV0VNGxjn3/8MNe0tEjKyCP0eN1wrK7QwGWi/zNAUG1wuYSj5 /DNA== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:message-id:user-agent :references:in-reply-to:subject:cc:to:from:date:mime-version; bh=oVndCYKruDQUvzQPkqVheLaUHdakIDR9EorE4RinZpI=; b=BXpWFrVJWTbaesK4aKu4NF8HJr52Emje02PbQJpGs4bTZ4cT53hcF53Ij8l/FNfSMa o5mWZgoLv8+fIgSQSFu/gtz9EyYsbS/pFJXsHiyYl/VNOScOldz/l35WgdKKmz1+5L/N tOURFzDQspycfdUTGMVYfz+VQLYpECYOb1iRrOkDbFV0LlMxVfK+90iVc1yfXapDbJzx YszUKAnm3ej/keAgeutx8n46EZQj5MmHqCEYFG58832VgkL3Bkbi3F12mr2XfRbcQ6cr q2HeFtcvRjOej9uAilbSh5rxXWtTty8whmV+qcan2U0AHLRGbZKuCTzRk5NJdNOTqbpz hRzw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id cs13-20020a170906dc8d00b006fe9e0df24dsi1744545ejc.876.2022.07.21.01.04.44; Thu, 21 Jul 2022 01:05:10 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S231254AbiGUHxh (ORCPT + 99 others); Thu, 21 Jul 2022 03:53:37 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:59056 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S229539AbiGUHxe (ORCPT ); Thu, 21 Jul 2022 03:53:34 -0400 Received: from 3.mo583.mail-out.ovh.net (3.mo583.mail-out.ovh.net [46.105.40.108]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 18F597CB6D for ; Thu, 21 Jul 2022 00:53:33 -0700 (PDT) Received: from player770.ha.ovh.net (unknown [10.109.138.52]) by mo583.mail-out.ovh.net (Postfix) with ESMTP id C627F247A1 for ; Thu, 21 Jul 2022 07:45:21 +0000 (UTC) Received: from RCM-web2.webmail.mail.ovh.net (ip-194-187-74-233.konfederacka.maverick.com.pl [194.187.74.233]) (Authenticated sender: rafal@milecki.pl) by player770.ha.ovh.net (Postfix) with ESMTPSA id 1AB9D2CDC81C6; Thu, 21 Jul 2022 07:44:57 +0000 (UTC) MIME-Version: 1.0 Date: Thu, 21 Jul 2022 09:44:57 +0200 From: =?UTF-8?Q?Rafa=C5=82_Mi=C5=82ecki?= To: William Zhang Cc: Linux ARM List , joel.peshkin@broadcom.com, dan.beygelman@broadcom.com, Miquel Raynal , "David S. Miller" , Rob Herring , Bjorn Helgaas , Kishon Vijay Abraham I , Vinod Koul , Linus Walleij , Philipp Zabel , Florian Fainelli , Greg Kroah-Hartman , Wim Van Sebroeck , linux-i2c@vger.kernel.org, linux-kernel@vger.kernel.org, linux-mtd@lists.infradead.org, netdev@vger.kernel.org, linux-pci@vger.kernel.org, linux-phy@lists.infradead.org, linux-gpio@vger.kernel.org, linux-mips@vger.kernel.org, linux-serial@vger.kernel.org, linux-watchdog@vger.kernel.org Subject: Re: [RESEND PATCH 6/9] arm64: bcmbca: Make BCM4908 drivers depend on ARCH_BCMBCA In-Reply-To: <20220721000740.29624-1-william.zhang@broadcom.com> References: <20220721000740.29624-1-william.zhang@broadcom.com> User-Agent: Roundcube Webmail/1.4.13 Message-ID: X-Sender: rafal@milecki.pl X-Originating-IP: 194.187.74.233 X-Webmail-UserID: rafal@milecki.pl Content-Type: text/plain; charset=US-ASCII; format=flowed Content-Transfer-Encoding: 7bit X-Ovh-Tracer-Id: 293015452666211156 X-VR-SPAMSTATE: OK X-VR-SPAMSCORE: -100 X-VR-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrudelkedgvdejucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecuqfggjfdpvefjgfevmfevgfenuceurghilhhouhhtmecuhedttdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhepggffhffvvefujghffgfkgihitgfgsehtjehjtddtredvnecuhfhrohhmpeftrghfrghlpgfoihhlvggtkhhiuceorhgrfhgrlhesmhhilhgvtghkihdrphhlqeenucggtffrrghtthgvrhhnpeegvdffjeelvdeggeetheegveejieetgeeiiefggeelveejffehieekhfduueelhfenucfkpheptddrtddrtddrtddpudelgedrudekjedrjeegrddvfeefnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehmohguvgepshhmthhpohhuthdphhgvlhhopehplhgrhigvrhejjedtrdhhrgdrohhvhhdrnhgvthdpihhnvghtpedtrddtrddtrddtpdhmrghilhhfrhhomheprhgrfhgrlhesmhhilhgvtghkihdrphhlpdhnsggprhgtphhtthhopedupdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdfovfetjfhoshhtpehmohehkeef X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,RCVD_IN_DNSWL_NONE, RCVD_IN_MSPIKE_H3,RCVD_IN_MSPIKE_WL,SPF_HELO_NONE,SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org On 2022-07-21 02:07, William Zhang wrote: > Replace ARCH_BCM4908 with ARCH_BCMBCA in subsystem Kconfig files. This change will make symbols (and relevant drivers): 1. MTD_OF_PARTS_BCM4908 2. MTD_OF_PARTS_LINKSYS_NS 3. BCM4908_ENET 4. PINCTRL_BCM4908 available on all BCA (sub)families. Above drivers are BCM4908 specific and I think they will never be needed for other BCA (sub)families. That list seems to be growing big: BCM47622, BCM4912 BCM63138, BCM63146, BCM63148, BCM63158, BCM63178, BCM6756, BCM6813, BCM6846, BCM6855, BCM6856, BCM6858, BCM6878. So I'm still wondering if dropping ARCH_BCM4908 makes sense. It seems to me we're saving 10 lines of clean Kconfig code while introducing a bit of mess to kernel config. If you take a look at Documentation/kbuild/kconfig-language.rst it says that symbols visibility should be limited to platform(s) (check the "Architecture and platform dependencies" part). There is there is however no clear documentation what platform should be. Personally I think I'd: 1. Keep ARCH_BCM4908 for BCM4908 (BCM4906 too) specific stuff 2. Use ARCH_BCMBCA for actual BCA-generic drivers (serial, WD, PMB) I'm happy to hear other maintainers opinions. > Signed-off-by: William Zhang > --- > > drivers/i2c/busses/Kconfig | 4 ++-- > drivers/mtd/parsers/Kconfig | 6 +++--- > drivers/net/ethernet/broadcom/Kconfig | 4 ++-- > drivers/pci/controller/Kconfig | 2 +- > drivers/phy/broadcom/Kconfig | 4 ++-- > drivers/pinctrl/bcm/Kconfig | 4 ++-- > drivers/reset/Kconfig | 2 +- > drivers/soc/bcm/bcm63xx/Kconfig | 4 ++-- > drivers/tty/serial/Kconfig | 4 ++-- > drivers/watchdog/Kconfig | 2 +- > 10 files changed, 18 insertions(+), 18 deletions(-) > > diff --git a/drivers/i2c/busses/Kconfig b/drivers/i2c/busses/Kconfig > index 45a4e9f1b639..fd9a4dd01997 100644 > --- a/drivers/i2c/busses/Kconfig > +++ b/drivers/i2c/busses/Kconfig > @@ -487,8 +487,8 @@ config I2C_BCM_KONA > > config I2C_BRCMSTB > tristate "BRCM Settop/DSL I2C controller" > - depends on ARCH_BCM2835 || ARCH_BCM4908 || ARCH_BCMBCA || \ > - ARCH_BRCMSTB || BMIPS_GENERIC || COMPILE_TEST > + depends on ARCH_BCM2835 || ARCH_BCMBCA || ARCH_BRCMSTB || \ > + BMIPS_GENERIC || COMPILE_TEST > default y > help > If you say yes to this option, support will be included for the > diff --git a/drivers/mtd/parsers/Kconfig b/drivers/mtd/parsers/Kconfig > index b43df73927a0..d6db655a1d24 100644 > --- a/drivers/mtd/parsers/Kconfig > +++ b/drivers/mtd/parsers/Kconfig > @@ -69,8 +69,8 @@ config MTD_OF_PARTS > > config MTD_OF_PARTS_BCM4908 > bool "BCM4908 partitioning support" > - depends on MTD_OF_PARTS && (ARCH_BCM4908 || COMPILE_TEST) > - default ARCH_BCM4908 > + depends on MTD_OF_PARTS && (ARCH_BCMBCA || COMPILE_TEST) > + default ARCH_BCMBCA > help > This provides partitions parser for BCM4908 family devices > that can have multiple "firmware" partitions. It takes care of > @@ -78,7 +78,7 @@ config MTD_OF_PARTS_BCM4908 > > config MTD_OF_PARTS_LINKSYS_NS > bool "Linksys Northstar partitioning support" > - depends on MTD_OF_PARTS && (ARCH_BCM_5301X || ARCH_BCM4908 || > COMPILE_TEST) > + depends on MTD_OF_PARTS && (ARCH_BCM_5301X || ARCH_BCMBCA || > COMPILE_TEST) > default ARCH_BCM_5301X > help > This provides partitions parser for Linksys devices based on > Broadcom > diff --git a/drivers/net/ethernet/broadcom/Kconfig > b/drivers/net/ethernet/broadcom/Kconfig > index 56e0fb07aec7..f4e1ca68d831 100644 > --- a/drivers/net/ethernet/broadcom/Kconfig > +++ b/drivers/net/ethernet/broadcom/Kconfig > @@ -53,8 +53,8 @@ config B44_PCI > > config BCM4908_ENET > tristate "Broadcom BCM4908 internal mac support" > - depends on ARCH_BCM4908 || COMPILE_TEST > - default y if ARCH_BCM4908 > + depends on ARCH_BCMBCA || COMPILE_TEST > + default y if ARCH_BCMBCA > help > This driver supports Ethernet controller integrated into Broadcom > BCM4908 family SoCs. > diff --git a/drivers/pci/controller/Kconfig > b/drivers/pci/controller/Kconfig > index d1c5fcf00a8a..bfd9bac37e24 100644 > --- a/drivers/pci/controller/Kconfig > +++ b/drivers/pci/controller/Kconfig > @@ -274,7 +274,7 @@ config VMD > > config PCIE_BRCMSTB > tristate "Broadcom Brcmstb PCIe host controller" > - depends on ARCH_BRCMSTB || ARCH_BCM2835 || ARCH_BCM4908 || \ > + depends on ARCH_BRCMSTB || ARCH_BCM2835 || ARCH_BCMBCA || \ > BMIPS_GENERIC || COMPILE_TEST > depends on OF > depends on PCI_MSI_IRQ_DOMAIN > diff --git a/drivers/phy/broadcom/Kconfig > b/drivers/phy/broadcom/Kconfig > index 93a6a8ee4716..1d89a2fd9b79 100644 > --- a/drivers/phy/broadcom/Kconfig > +++ b/drivers/phy/broadcom/Kconfig > @@ -93,11 +93,11 @@ config PHY_BRCM_SATA > > config PHY_BRCM_USB > tristate "Broadcom STB USB PHY driver" > - depends on ARCH_BCM4908 || ARCH_BRCMSTB || COMPILE_TEST > + depends on ARCH_BCMBCA || ARCH_BRCMSTB || COMPILE_TEST > depends on OF > select GENERIC_PHY > select SOC_BRCMSTB if ARCH_BRCMSTB > - default ARCH_BCM4908 || ARCH_BRCMSTB > + default ARCH_BCMBCA || ARCH_BRCMSTB > help > Enable this to support the Broadcom STB USB PHY. > This driver is required by the USB XHCI, EHCI and OHCI > diff --git a/drivers/pinctrl/bcm/Kconfig b/drivers/pinctrl/bcm/Kconfig > index 8f4d89806fcb..35b51ce4298e 100644 > --- a/drivers/pinctrl/bcm/Kconfig > +++ b/drivers/pinctrl/bcm/Kconfig > @@ -31,13 +31,13 @@ config PINCTRL_BCM2835 > > config PINCTRL_BCM4908 > tristate "Broadcom BCM4908 pinmux driver" > - depends on OF && (ARCH_BCM4908 || COMPILE_TEST) > + depends on OF && (ARCH_BCMBCA || COMPILE_TEST) > select PINMUX > select PINCONF > select GENERIC_PINCONF > select GENERIC_PINCTRL_GROUPS > select GENERIC_PINMUX_FUNCTIONS > - default ARCH_BCM4908 > + default ARCH_BCMBCA > help > Driver for BCM4908 family SoCs with integrated pin controller. > > diff --git a/drivers/reset/Kconfig b/drivers/reset/Kconfig > index f9a7cee01659..7ae71535fe2a 100644 > --- a/drivers/reset/Kconfig > +++ b/drivers/reset/Kconfig > @@ -201,7 +201,7 @@ config RESET_SCMI > > config RESET_SIMPLE > bool "Simple Reset Controller Driver" if COMPILE_TEST || EXPERT > - default ARCH_ASPEED || ARCH_BCM4908 || ARCH_BITMAIN || ARCH_REALTEK > || ARCH_STM32 || (ARCH_INTEL_SOCFPGA && ARM64) || ARCH_SUNXI || ARC > + default ARCH_ASPEED || ARCH_BCMBCA || ARCH_BITMAIN || ARCH_REALTEK > || ARCH_STM32 || (ARCH_INTEL_SOCFPGA && ARM64) || ARCH_SUNXI || ARC > help > This enables a simple reset controller driver for reset lines that > that can be asserted and deasserted by toggling bits in a > contiguous, > diff --git a/drivers/soc/bcm/bcm63xx/Kconfig > b/drivers/soc/bcm/bcm63xx/Kconfig > index 9e501c8ac5ce..355c34482076 100644 > --- a/drivers/soc/bcm/bcm63xx/Kconfig > +++ b/drivers/soc/bcm/bcm63xx/Kconfig > @@ -13,8 +13,8 @@ endif # SOC_BCM63XX > > config BCM_PMB > bool "Broadcom PMB (Power Management Bus) driver" > - depends on ARCH_BCM4908 || (COMPILE_TEST && OF) > - default ARCH_BCM4908 > + depends on ARCH_BCMBCA || (COMPILE_TEST && OF) > + default ARCH_BCMBCA > select PM_GENERIC_DOMAINS if PM > help > This enables support for the Broadcom's PMB (Power Management Bus) > that > diff --git a/drivers/tty/serial/Kconfig b/drivers/tty/serial/Kconfig > index e3279544b03c..f32bb01c3feb 100644 > --- a/drivers/tty/serial/Kconfig > +++ b/drivers/tty/serial/Kconfig > @@ -1100,8 +1100,8 @@ config SERIAL_TIMBERDALE > config SERIAL_BCM63XX > tristate "Broadcom BCM63xx/BCM33xx UART support" > select SERIAL_CORE > - depends on ARCH_BCM4908 || ARCH_BCMBCA || BCM63XX || BMIPS_GENERIC > || COMPILE_TEST > - default ARCH_BCM4908 || ARCH_BCMBCA || BCM63XX || BMIPS_GENERIC > + depends on ARCH_BCMBCA || BCM63XX || BMIPS_GENERIC || COMPILE_TEST > + default ARCH_BCMBCA || BCM63XX || BMIPS_GENERIC > help > This enables the driver for the onchip UART core found on > the following chipsets: > diff --git a/drivers/watchdog/Kconfig b/drivers/watchdog/Kconfig > index 32fd37698932..1f85ec8a4b3b 100644 > --- a/drivers/watchdog/Kconfig > +++ b/drivers/watchdog/Kconfig > @@ -1798,7 +1798,7 @@ config BCM7038_WDT > tristate "BCM63xx/BCM7038 Watchdog" > select WATCHDOG_CORE > depends on HAS_IOMEM > - depends on ARCH_BCM4908 || ARCH_BRCMSTB || BMIPS_GENERIC || BCM63XX > || COMPILE_TEST > + depends on ARCH_BCMBCA || ARCH_BRCMSTB || BMIPS_GENERIC || BCM63XX > || COMPILE_TEST > help > Watchdog driver for the built-in hardware in Broadcom 7038 and > later SoCs used in set-top boxes. BCM7038 was made public