Received: by 2002:a05:6359:c8b:b0:c7:702f:21d4 with SMTP id go11csp67811rwb; Wed, 5 Oct 2022 14:52:03 -0700 (PDT) X-Google-Smtp-Source: AMsMyM4CLQn+pfDrdXykTEfGG9BYr3MZrOz/fxwKoUERUSGsoik6pvzAU0hrJMogwrc9vLPzxv9t X-Received: by 2002:aa7:93dc:0:b0:561:7622:5c0e with SMTP id y28-20020aa793dc000000b0056176225c0emr1834045pff.46.1665006723252; Wed, 05 Oct 2022 14:52:03 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1665006723; cv=none; d=google.com; s=arc-20160816; b=ejEWyi4aYgIOnj+qElxpEFJ/C/foYNu6OFie7jZ04o+yAAaVYrDJF6oQDGAEwkQm98 bAe9gUzXcgLutGMunHYWCBd5upTcNdCSadtwciv0wI/HYvN+ORM6uOF1+BvkaYSqSnhD bAaGfW8lLDGn9w5APsOOlguo93NWRGKq4OSPvpQn24iESboXO40tEfXm9zUkbg5feqlK TUzk26uXRmi66Pn1bniLbfMvfBCsxwOYvuYvBX+1baZVxIyweFbTDtaSvsy7O1fGYE2c Z2iQ35gEYCxwspF91p0b4CoQCBxA0JFsqPb4IVfGgO2Wr4yLb/jqENU66F9BfR2zsDuV 4zqw== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:in-reply-to:content-disposition:mime-version :references:message-id:subject:cc:to:from:date:dkim-signature; bh=6nswR+3d/gnwoaF8K8U30+q9DQCaCZojzetu+lImvbk=; b=BliehkE5FCb+yMNQlwcPp6jWKuG0dFXYbwVdyxP4cOLVHcpqn3ucz4qE7wQ1iarj6w IUuMpVMoaCZGtCBSWru4J9pcTuz6UNd58KGlwuXHwboRP+HsGZhQcONkHu7YNDCr4WWF 65m22Zaj5KRp3OYK7sgwRoXxiMBbAkMa5y9e7R5h7FRXXCWDaB3qRgsUx/dtkK/44F/M TkzLnsCP+ee7kiqFEP8vBF0j2kTiGpX1WXKSljBaTYpZmUsnOBK2jsAwzmoogaKcLh5/ QYo95ozV4KEBSBH1QSRSQ3oMhqsb25/MnFbSoNXYPqXppz9Tq1shuqYQxJvtWed6zPsi gwHQ== ARC-Authentication-Results: i=1; mx.google.com; dkim=pass header.i=@comcastmailservice.net header.s=20211018a header.b=MRvNNV90; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id e69-20020a636948000000b0043945685064si16069786pgc.26.2022.10.05.14.51.50; Wed, 05 Oct 2022 14:52:03 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; dkim=pass header.i=@comcastmailservice.net header.s=20211018a header.b=MRvNNV90; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230117AbiJEVYE (ORCPT + 99 others); Wed, 5 Oct 2022 17:24:04 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:54466 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230037AbiJEVYA (ORCPT ); Wed, 5 Oct 2022 17:24:00 -0400 Received: from resqmta-c1p-024061.sys.comcast.net (resqmta-c1p-024061.sys.comcast.net [IPv6:2001:558:fd00:56::6]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 1DC1B816B2 for ; Wed, 5 Oct 2022 14:23:57 -0700 (PDT) Received: from resomta-c1p-023411.sys.comcast.net ([96.102.18.231]) by resqmta-c1p-024061.sys.comcast.net with ESMTP id g8x5oTWNWovHsgBrxoPuHt; Wed, 05 Oct 2022 21:23:57 +0000 DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=comcastmailservice.net; s=20211018a; t=1665005037; bh=6nswR+3d/gnwoaF8K8U30+q9DQCaCZojzetu+lImvbk=; h=Received:Received:Received:Date:From:To:Subject:Message-ID: MIME-Version:Content-Type; b=MRvNNV90DHMgWz6rL6ZmC7gjlnU4ZShmGi8KfzDiRTVzD5vyNEXbwQgEi5C+r1u+x QQqhjSQswHaSCq7GGVafFMxkj/8DH19vL/LhGRbn2LAtN6+s6mIWf4T1nLKH49zaFz +HRRSoS/V3cVxzc8lx5MO3xOcs7qHQlK6GxpmYwPI4ntqljRs4g74gKNB15DOIOWyq XnzJLGhmG6krLTxcJ+k+H2fhLUkQSeafKQLvJth+uWdU/bpJIUsUdwDC02JMQcYTnV KsRmNcPVL9fQD52hdPKJyhVTnjm9CK00+61YtOUHUyL7nfr1uAu4MJbAdxCXOxrqb+ T3gbWgSO15+gA== Received: from Outgoing.brak ([69.249.67.241]) by resomta-c1p-023411.sys.comcast.net with ESMTPSA id gBrZoG0Iq563TgBrZo9LmJ; Wed, 05 Oct 2022 21:23:35 +0000 X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedvfedrfeeifedgudehlecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenfghrlhcuvffnffculddvfedmnecujfgurhepfffhvfevuffkfhggtggujgesthdtredttddtvdenucfhrhhomheprfgruhhlucffihhnohculfhonhgvshcuoehprghulhesshhprggtvghfrhgvrghkudekrdighiiiqeenucggtffrrghtthgvrhhnpeffieeijedvffekteevtdehffeffeetvdehfeehkeehieevtedthfeuveeugefgveenucffohhmrghinhepghhithhhuhgsrdgtohhmpdifihhnvghhqhdrohhrghenucfkphepieelrddvgeelrdeijedrvdegudenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhephhgvlhhopefquhhtghhoihhnghdrsghrrghkpdhinhgvthepieelrddvgeelrdeijedrvdeguddpmhgrihhlfhhrohhmpehprghulhesshhprggtvghfrhgvrghkudekrdighiiipdhnsggprhgtphhtthhopeehpdhrtghpthhtoheprghnshhsihdrhhgrnhhnuhhlrgesihhkihdrfhhipdhrtghpthhtohepjhhikhhosheskhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqihhnphhuthesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnh gvlhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhushgssehvghgvrhdrkhgvrhhnvghlrdhorhhg X-Xfinity-VMeta: sc=-77.00;st=legit Received: from localhost.localdomain (unknown [172.18.18.119]) by Outgoing.brak (Postfix) with ESMTPSA id EE639B38E564; Wed, 5 Oct 2022 21:23:32 +0000 (UTC) Date: Wed, 5 Oct 2022 21:30:21 +0000 From: Paul Dino Jones To: Anssi Hannula Cc: jikos@kernel.org, linux-kernel@vger.kernel.org, linux-input@vger.kernel.org, linux-usb@vger.kernel.org Subject: Re: [PATCH] usbhid: Interpret 0 length ff effects as infinite (0xffff) length effects Message-ID: <20221005213021.adhxibb5ipbrjdnn@localhost.localdomain> References: <20221001221657.gexisc2egjn3mpog@localhost.localdomain> <93f708f3f9ac8b5c94e6d0b86c1efaa3@iki.fi> MIME-Version: 1.0 Content-Type: text/plain; charset=us-ascii Content-Disposition: inline In-Reply-To: <93f708f3f9ac8b5c94e6d0b86c1efaa3@iki.fi> X-Spam-Status: No, score=-1.2 required=5.0 tests=BAYES_00,DKIM_SIGNED, DKIM_VALID,FROM_SUSPICIOUS_NTLD,SPF_HELO_PASS,SPF_SOFTFAIL autolearn=no autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org Hello, and thank you for considering this. Yes, Wine 7 breaks a lot of stuff for me, and I've been using Wine 5.x and 6.x through Proton which isn't ideal when trying to isolate problems. It seems there is atleast some precedence in other force feedback drivers for using 0 as some sort of indicator for an infinite effect: https://github.com/gotzl/hid-fanatecff/blob/next/hid-ftecff.c#L724 https://github.com/berarma/new-lg4ff/blob/master/hid-lg4ff.c#L762 We also discussed this issue at this thread: https://github.com/berarma/ffbtools/issues/26 I've also read some indication that the SimCube wheel works on Linux, so I'd be interested in how that is handling this situation. --- Paul Dino Jones > Paul Dino Jones kirjoitti 2022-10-02 01:16: > > Greetings, > > Hello, and thanks for looking into this! > > > I started using my Accuforce V2 sim wheel on Linux. I was getting no > > response from racing simulators through wine, while native linux test > > tools worked properly. It appears that many real-world applications will > > send 0 as the replay length, which was resulting in the behavior I was > > observing (nothing). The PID document does not explicitly state that 0 > > length effects should be interpreted as infinite, but it does mention > > null effects being infinite effects. > > Actually, it is Wine that is translating 0xFFFF from the application to > 0x0000 for the Linux FF API: > https://gitlab.winehq.org/wine/wine/-/blob/master/dlls/winebus.sys/bus_udev.c#L1124 > > Unfortunately "infinite" duration is not actually specified at all in our > API currently. > input.h just says that the all durations are in msecs and values above > 0x7fff cause unspecified results. > > We have three places where the duration is handled: > - ff-memless: Considers 0 as infinite (in ml_get_combo_effect() and > calculate_next_time()). > - iforce-ff: Just passes the duration to HW as-is - it is unknown what > counts as infinite, if any. > - pidff: Just passes the duration to HW as-is, so using the > unspecified-by-API 0xffff results in infinite duration (per USB HID PID > spec). > > So we probably want to specify some value to work as infinite, likely either > 0 or 0xFFFF, and explicitly document that in input.h. > I suspect that ff-memless devices are currently the most popular, and e.g. > Wine already assumes 0 is infinite, and I can't think of a reason to have an > "actual" 0-duration effect, so I guess 0 would be the most sensible value. > > Since iforce is an "ancestor" of HID PID of sorts, it may also support > 0xffff = infinite. > I'll try to get hold of one to test, though it may take a couple of weeks... > > > > This patch will interpret 0 length force feedback effects as 0xffff > > (infinite) length effects, leaving other values for replay length > > unchanged. > > > > Signed-off-by: Paul Dino Jones > > --- > > drivers/hid/usbhid/hid-pidff.c | 2 +- > > 1 file changed, 1 insertion(+), 1 deletion(-) > > > > diff --git a/drivers/hid/usbhid/hid-pidff.c > > b/drivers/hid/usbhid/hid-pidff.c > > index 3b4ee21cd811..70653451c860 100644 > > --- a/drivers/hid/usbhid/hid-pidff.c > > +++ b/drivers/hid/usbhid/hid-pidff.c > > @@ -301,7 +301,7 @@ static void pidff_set_effect_report(struct > > pidff_device *pidff, > > pidff->block_load[PID_EFFECT_BLOCK_INDEX].value[0]; > > pidff->set_effect_type->value[0] = > > pidff->create_new_effect_type->value[0]; > > - pidff->set_effect[PID_DURATION].value[0] = effect->replay.length; > > + pidff->set_effect[PID_DURATION].value[0] = effect->replay.length == > > 0 ? 0xffff : effect->replay.length; > > pidff->set_effect[PID_TRIGGER_BUTTON].value[0] = > > effect->trigger.button; > > pidff->set_effect[PID_TRIGGER_REPEAT_INT].value[0] = > > effect->trigger.interval; > > -- > Anssi Hannula >