Received: by 2002:a05:6358:1087:b0:cb:c9d3:cd90 with SMTP id j7csp7598019rwi; Mon, 24 Oct 2022 17:25:02 -0700 (PDT) X-Google-Smtp-Source: AMsMyM6guuEZj1gyXJNmYq3/Y099pHLjMU4UpviShgARFc/+tz9QQBV+DRmgDL31JQdpwZO6qI0Z X-Received: by 2002:a05:6402:4029:b0:45b:d50c:b9b0 with SMTP id d41-20020a056402402900b0045bd50cb9b0mr32937439eda.126.1666657502509; Mon, 24 Oct 2022 17:25:02 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1666657502; cv=none; d=google.com; s=arc-20160816; b=FsNHw1VPJQYRvxe5gyFUP1qptRadPxNNgDjbfN+r057W3clumgLyJ2tvbggY4PeEBg PN98UigygH14AuSGw/lPg3AvP2KChyW/obya1KV8u71Ws2/TskH4gDPTGPolKS186+T5 PzUmudBlMdy/ohOfMGcCIm4esroA2eIrS73JLVAGW8A6y7BmVc1FBGg/qiE9NwKoh4Sl 4GlLJRG4OEefRIN2Ot67dxxmucalmgt6oT8NTyAOg/8isef7OtJIazVJhceZcPmF7kof eXg4PNVArAPAlfxoZfBQtoiYbnepD2jjYHkzbCGruQxSp2F8qpBZV6jyuZq7Q9g/wC4G l4Qg== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=PtEw5+vs6X0FyIe/3zYCAVI1EuFLHMJdNotHQJyXq0w=; b=Z6Rrr5c1GTnx2630NoyzKMW9FqXtJp3FdZZHYUiQuIFDu0Er1Qrfh8ipf+b+gQsQ7X yk6Djg3plhOuQxezpaz9vTspVHVoFtIqW0YfGXtmmK7XYUJCq43z+j43WwzlV1HllThO RrOTlaj6VEXDOKP/4pqrBEmXtc6t9+xerjpvClY7EnBBqiOx5vS/sAPQUEaJUpug6WA8 7C0rAOyvfJXPWlk3Qzavy9wFmdO6IPL32FwcT4YIOBQjzMa2psE+XYcmI1cESVulU6/Y b8gNYJnayFUgZ/lrsn2qTqqpwvT4TrqB56p1rCf5uzHUN0pOgU4+x/LnC6m7+p9YlAYd mdiw== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id b25-20020aa7cd19000000b0045d2727331csi1091582edw.282.2022.10.24.17.24.38; Mon, 24 Oct 2022 17:25:02 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S230144AbiJXXxW (ORCPT + 99 others); Mon, 24 Oct 2022 19:53:22 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:35264 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S230038AbiJXXxA (ORCPT ); Mon, 24 Oct 2022 19:53:00 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id 9127A3362FE; Mon, 24 Oct 2022 15:10:49 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.0.0) id 1e047c12660352c6; Mon, 24 Oct 2022 21:23:36 +0200 Received: from kreacher.localnet (unknown [213.134.163.181]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id 46B5F6692BC; Mon, 24 Oct 2022 21:23:35 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: LKML , Len Brown , Srinivas Pandruvada , Linux ACPI Subject: [PATCH v1 1/2] cpufreq: intel_pstate: Read all MSRs on the target CPU Date: Mon, 24 Oct 2022 21:21:00 +0200 Message-ID: <3195597.aeNJFYEL58@kreacher> In-Reply-To: <2258064.ElGaqSPkdT@kreacher> References: <2258064.ElGaqSPkdT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.163.181 X-CLIENT-HOSTNAME: 213.134.163.181 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvfedrgedtgedgudefudcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudeifedrudekudenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrdduieefrddukedupdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeehpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhgvnhdrsghrohifnhesihhnthgvlhdrtghomhdprhgtphhtthhopehsrhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghl rdgtohhmpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=5 Fuz1=5 Fuz2=5 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org From: Rafael J. Wysocki Some of the MSR accesses in intel_pstate are carried out on the CPU that is running the code, but the values coming from them are used for the performance scaling of the other CPUs. This is problematic, for example, on hybrid platforms where MSR_TURBO_RATIO_LIMIT for P-cores and E-cores is different, so the values read from it on a P-core are generally not applicable to E-cores and the other way around. For this reason, make the driver access all MSRs on the target CPU on platforms using the "core" pstate_funcs callbacks which is the case for all of the hybrid platforms released to date. For this purpose, pass a CPU argument to the ->get_max(), ->get_max_physical(), ->get_min() and ->get_turbo() pstate_funcs callbacks and from there pass it to rdmsrl_on_cpu() or rdmsrl_safe_on_cpu() to access the MSR on the target CPU. Fixes: 46573fd6369f ("cpufreq: intel_pstate: hybrid: Rework HWP calibration") Signed-off-by: Rafael J. Wysocki --- drivers/cpufreq/intel_pstate.c | 66 ++++++++++++++++++++--------------------- 1 file changed, 33 insertions(+), 33 deletions(-) Index: linux-pm/drivers/cpufreq/intel_pstate.c =================================================================== --- linux-pm.orig/drivers/cpufreq/intel_pstate.c +++ linux-pm/drivers/cpufreq/intel_pstate.c @@ -280,10 +280,10 @@ static struct cpudata **all_cpu_data; * structure is used to store those callbacks. */ struct pstate_funcs { - int (*get_max)(void); - int (*get_max_physical)(void); - int (*get_min)(void); - int (*get_turbo)(void); + int (*get_max)(int cpu); + int (*get_max_physical)(int cpu); + int (*get_min)(int cpu); + int (*get_turbo)(int cpu); int (*get_scaling)(void); int (*get_cpu_scaling)(int cpu); int (*get_aperf_mperf_shift)(void); @@ -531,12 +531,12 @@ static void intel_pstate_hybrid_hwp_adju { int perf_ctl_max_phys = cpu->pstate.max_pstate_physical; int perf_ctl_scaling = cpu->pstate.perf_ctl_scaling; - int perf_ctl_turbo = pstate_funcs.get_turbo(); + int perf_ctl_turbo = pstate_funcs.get_turbo(cpu->cpu); int turbo_freq = perf_ctl_turbo * perf_ctl_scaling; int scaling = cpu->pstate.scaling; pr_debug("CPU%d: perf_ctl_max_phys = %d\n", cpu->cpu, perf_ctl_max_phys); - pr_debug("CPU%d: perf_ctl_max = %d\n", cpu->cpu, pstate_funcs.get_max()); + pr_debug("CPU%d: perf_ctl_max = %d\n", cpu->cpu, pstate_funcs.get_max(cpu->cpu)); pr_debug("CPU%d: perf_ctl_turbo = %d\n", cpu->cpu, perf_ctl_turbo); pr_debug("CPU%d: perf_ctl_scaling = %d\n", cpu->cpu, perf_ctl_scaling); pr_debug("CPU%d: HWP_CAP guaranteed = %d\n", cpu->cpu, cpu->pstate.max_pstate); @@ -1740,7 +1740,7 @@ static void intel_pstate_hwp_enable(stru intel_pstate_update_epp_defaults(cpudata); } -static int atom_get_min_pstate(void) +static int atom_get_min_pstate(int not_used) { u64 value; @@ -1748,7 +1748,7 @@ static int atom_get_min_pstate(void) return (value >> 8) & 0x7F; } -static int atom_get_max_pstate(void) +static int atom_get_max_pstate(int not_used) { u64 value; @@ -1756,7 +1756,7 @@ static int atom_get_max_pstate(void) return (value >> 16) & 0x7F; } -static int atom_get_turbo_pstate(void) +static int atom_get_turbo_pstate(int not_used) { u64 value; @@ -1834,23 +1834,23 @@ static void atom_get_vid(struct cpudata cpudata->vid.turbo = value & 0x7f; } -static int core_get_min_pstate(void) +static int core_get_min_pstate(int cpu) { u64 value; - rdmsrl(MSR_PLATFORM_INFO, value); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &value); return (value >> 40) & 0xFF; } -static int core_get_max_pstate_physical(void) +static int core_get_max_pstate_physical(int cpu) { u64 value; - rdmsrl(MSR_PLATFORM_INFO, value); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &value); return (value >> 8) & 0xFF; } -static int core_get_tdp_ratio(u64 plat_info) +static int core_get_tdp_ratio(int cpu, u64 plat_info) { /* Check how many TDP levels present */ if (plat_info & 0x600000000) { @@ -1860,13 +1860,13 @@ static int core_get_tdp_ratio(u64 plat_i int err; /* Get the TDP level (0, 1, 2) to get ratios */ - err = rdmsrl_safe(MSR_CONFIG_TDP_CONTROL, &tdp_ctrl); + err = rdmsrl_safe_on_cpu(cpu, MSR_CONFIG_TDP_CONTROL, &tdp_ctrl); if (err) return err; /* TDP MSR are continuous starting at 0x648 */ tdp_msr = MSR_CONFIG_TDP_NOMINAL + (tdp_ctrl & 0x03); - err = rdmsrl_safe(tdp_msr, &tdp_ratio); + err = rdmsrl_safe_on_cpu(cpu, tdp_msr, &tdp_ratio); if (err) return err; @@ -1883,7 +1883,7 @@ static int core_get_tdp_ratio(u64 plat_i return -ENXIO; } -static int core_get_max_pstate(void) +static int core_get_max_pstate(int cpu) { u64 tar; u64 plat_info; @@ -1891,10 +1891,10 @@ static int core_get_max_pstate(void) int tdp_ratio; int err; - rdmsrl(MSR_PLATFORM_INFO, plat_info); + rdmsrl_on_cpu(cpu, MSR_PLATFORM_INFO, &plat_info); max_pstate = (plat_info >> 8) & 0xFF; - tdp_ratio = core_get_tdp_ratio(plat_info); + tdp_ratio = core_get_tdp_ratio(cpu, plat_info); if (tdp_ratio <= 0) return max_pstate; @@ -1903,7 +1903,7 @@ static int core_get_max_pstate(void) return tdp_ratio; } - err = rdmsrl_safe(MSR_TURBO_ACTIVATION_RATIO, &tar); + err = rdmsrl_safe_on_cpu(cpu, MSR_TURBO_ACTIVATION_RATIO, &tar); if (!err) { int tar_levels; @@ -1918,13 +1918,13 @@ static int core_get_max_pstate(void) return max_pstate; } -static int core_get_turbo_pstate(void) +static int core_get_turbo_pstate(int cpu) { u64 value; int nont, ret; - rdmsrl(MSR_TURBO_RATIO_LIMIT, value); - nont = core_get_max_pstate(); + rdmsrl_on_cpu(cpu, MSR_TURBO_RATIO_LIMIT, &value); + nont = core_get_max_pstate(cpu); ret = (value) & 255; if (ret <= nont) ret = nont; @@ -1952,13 +1952,13 @@ static int knl_get_aperf_mperf_shift(voi return 10; } -static int knl_get_turbo_pstate(void) +static int knl_get_turbo_pstate(int cpu) { u64 value; int nont, ret; - rdmsrl(MSR_TURBO_RATIO_LIMIT, value); - nont = core_get_max_pstate(); + rdmsrl_on_cpu(cpu, MSR_TURBO_RATIO_LIMIT, &value); + nont = core_get_max_pstate(cpu); ret = (((value) >> 8) & 0xFF); if (ret <= nont) ret = nont; @@ -2025,10 +2025,10 @@ static void intel_pstate_max_within_limi static void intel_pstate_get_cpu_pstates(struct cpudata *cpu) { - int perf_ctl_max_phys = pstate_funcs.get_max_physical(); + int perf_ctl_max_phys = pstate_funcs.get_max_physical(cpu->cpu); int perf_ctl_scaling = pstate_funcs.get_scaling(); - cpu->pstate.min_pstate = pstate_funcs.get_min(); + cpu->pstate.min_pstate = pstate_funcs.get_min(cpu->cpu); cpu->pstate.max_pstate_physical = perf_ctl_max_phys; cpu->pstate.perf_ctl_scaling = perf_ctl_scaling; @@ -2044,8 +2044,8 @@ static void intel_pstate_get_cpu_pstates } } else { cpu->pstate.scaling = perf_ctl_scaling; - cpu->pstate.max_pstate = pstate_funcs.get_max(); - cpu->pstate.turbo_pstate = pstate_funcs.get_turbo(); + cpu->pstate.max_pstate = pstate_funcs.get_max(cpu->cpu); + cpu->pstate.turbo_pstate = pstate_funcs.get_turbo(cpu->cpu); } if (cpu->pstate.scaling == perf_ctl_scaling) { @@ -3221,9 +3221,9 @@ static unsigned int force_load __initdat static int __init intel_pstate_msrs_not_valid(void) { - if (!pstate_funcs.get_max() || - !pstate_funcs.get_min() || - !pstate_funcs.get_turbo()) + if (!pstate_funcs.get_max(0) || + !pstate_funcs.get_min(0) || + !pstate_funcs.get_turbo(0)) return -ENODEV; return 0;