Received: by 2002:a05:6358:16cc:b0:ea:6187:17c9 with SMTP id r12csp8200036rwl; Tue, 10 Jan 2023 10:12:03 -0800 (PST) X-Google-Smtp-Source: AMrXdXs/Ih7/rB36vXWMzF39yUfC4fE5TfiOqEd/8TwMaDuKJanqX2WHc2JW863IoKXUewSheOyU X-Received: by 2002:a17:902:be05:b0:192:a4e5:ac5f with SMTP id r5-20020a170902be0500b00192a4e5ac5fmr42325295pls.61.1673374323719; Tue, 10 Jan 2023 10:12:03 -0800 (PST) ARC-Seal: i=1; a=rsa-sha256; t=1673374323; cv=none; d=google.com; s=arc-20160816; b=rSS1eKvgdiDTpLPGGWe/c6oPlMHvZaWzmuZtKWYT8W/h6Cr/QD2ExOtOZAkGKioaaq NvGi8oUNIjAApcj9OdEK06GBXQEZ4tsXbBI7l2ELk/9QyyDdqKB3AMBQRIKp4P1gngCi Lf6sr+2Yn5Sh+lGQkVdC0y0khRU/uLXKa9LEiY1jxC6zdTAcdcaQgm8HS55Q65MgQbvp AxJWa5ZDfJywlynuiRl1tCkWy+rog0VCfeFjBVLb8owMtpvYun8qE9xG5f3MjSaYiF2k gj5U/1Fu6dUZXvEjpcMRepldJN+oQ7TV+dII4TYmGVpuTpGwPA/87nnb9cZScPm6G9dv nDow== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=5x7yd394SG2MxbY34TrHnOzImKBG5VXVjK4HE3F4Y/A=; b=jDcVHwZ7f6rTKRFB3mKpzyr8n/TV5p9+UkeL8MCc7dBvK5Il5s9Sz6sxhYt3KoN5DC 43x04JA1fvNSNuQLw224cYv1GiMeSR98x1H9VtsHcpMJPoEaHvzPeaqgd2VBW0XutDhz DOQW2KGO1LJk5FIe7YSaTRuI5Fd4uddHk3cpPlhKEAqxndUTBdGPZpj+GuRbxV3ALady KJ/sXayMXSPPJyqBM16hgCoNWsYCyxcaBwI6iY6D4Bh6zC79nIGZYj5kAyaanaP9G/pN relg7Lx5vREH4o+i512RpPbh7RVhu1OLAXO5Zvu39KSdfzzoCdr92geei35aWnxvce9h 184Q== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from out1.vger.email (out1.vger.email. [2620:137:e000::1:20]) by mx.google.com with ESMTP id s18-20020a17090302d200b00189d63396c2si12092302plk.35.2023.01.10.10.11.56; Tue, 10 Jan 2023 10:12:03 -0800 (PST) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) client-ip=2620:137:e000::1:20; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::1:20 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S238705AbjAJSFc (ORCPT + 55 others); Tue, 10 Jan 2023 13:05:32 -0500 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:45336 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S233017AbjAJSEl (ORCPT ); Tue, 10 Jan 2023 13:04:41 -0500 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id A716C58307; Tue, 10 Jan 2023 10:02:18 -0800 (PST) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.1.0) id 28d6bfba788c9982; Tue, 10 Jan 2023 19:02:17 +0100 Received: from kreacher.localnet (unknown [213.134.183.108]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C39042624FFE; Tue, 10 Jan 2023 19:02:15 +0100 (CET) From: "Rafael J. Wysocki" To: Bjorn Helgaas Cc: "Limonciello, Mario" , "Rafael J. Wysocki" , Len Brown , Bjorn Helgaas , Mika Westerberg , Mehta Sanju , Lukas Wunner , "Rafael J . Wysocki" , linux-acpi@vger.kernel.org, linux-pci@vger.kernel.org, linux-kernel@vger.kernel.org Subject: Re: [PATCH v5] PCI/ACPI: PCI/ACPI: Validate devices with power resources support D3 Date: Tue, 10 Jan 2023 19:02:15 +0100 Message-ID: <5915557.lOV4Wx5bFT@kreacher> In-Reply-To: <1945994.PYKUYFuaPT@kreacher> References: <20221121221742.GA137841@bhelgaas> <8191575.T7Z3S40VBb@kreacher> <1945994.PYKUYFuaPT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 213.134.183.108 X-CLIENT-HOSTNAME: 213.134.183.108 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvhedrledvgdegiecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepvddufedrudefgedrudekfedruddtkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedvudefrddufeegrddukeefrddutdekpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeduvddprhgtphhtthhopehhvghlghgrrghssehkvghrnhgvlhdrohhrghdprhgtphhtthhopehmrghrihhordhlihhmohhntghivghllhhosegrmhgurdgtohhmpdhrtghpthhtoheprhgrfhgrvghlsehkvghrnhgvlhdrohhrghdprhgtphhtthhopehlvghnsgeskhgvrhhnvghlrdhorhhgpdhrtghpthhtohepsghhvghlghgrrghssehgohhoghhlvgdrtghomhdp rhgtphhtthhopehmihhkrgdrfigvshhtvghrsggvrhhgsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepufgrnhhjuhdrofgvhhhtrgesrghmugdrtghomhdprhgtphhtthhopehluhhkrghsseifuhhnnhgvrhdruggvpdhrtghpthhtoheprhgrfhgrvghlrdhjrdifhihsohgtkhhisehinhhtvghlrdgtohhmpdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphgtihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdhkvghrnhgvlhesvhhgvghrrdhkvghrnhgvlhdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=12 Fuz1=12 Fuz2=12 X-Spam-Status: No, score=-1.9 required=5.0 tests=BAYES_00,SPF_HELO_NONE, SPF_PASS autolearn=ham autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on lindbergh.monkeyblade.net Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org On Monday, January 2, 2023 5:59:36 PM CET Rafael J. Wysocki wrote: > On Monday, January 2, 2023 5:34:19 PM CET Rafael J. Wysocki wrote: > > On Monday, November 21, 2022 11:17:42 PM CET Bjorn Helgaas wrote: > > > On Mon, Nov 21, 2022 at 03:33:00PM +0100, Rafael J. Wysocki wrote: > > > > On Friday, November 18, 2022 10:13:39 PM CET Rafael J. Wysocki wrote: > > > > > On Fri, Nov 18, 2022 at 9:23 PM Bjorn Helgaas wrote: > > > > > > > > > > > > Hi Rafael, > > > > > > > > > > > > Sorry, I'm still confused (my perpetual state :)). > > > > > > > > > > No worries, doing my best to address that. > > > > > > > > > > > On Fri, Nov 18, 2022 at 02:16:17PM +0100, Rafael J. Wysocki wrote: > > > > > > > On Thu, Nov 17, 2022 at 11:16 PM Bjorn Helgaas wrote: > > > > > > > > On Thu, Nov 17, 2022 at 06:01:26PM +0100, Rafael J. Wysocki wrote: > > > > > > > > > On Thu, Nov 17, 2022 at 12:28 AM Bjorn Helgaas wrote: > > > > > > > > > > On Wed, Nov 16, 2022 at 01:00:36PM +0100, Rafael J. Wysocki wrote: > > > > > > > > > > > On Wed, Nov 16, 2022 at 1:37 AM Bjorn Helgaas wrote: > > > > > > > > > > > > On Mon, Nov 14, 2022 at 04:33:52PM +0100, Rafael J. Wysocki wrote: > > > > > > > > > > > > > On Fri, Nov 11, 2022 at 10:42 PM Bjorn Helgaas wrote: > > > > > > > > > > > > > > > > > > > > > > > > > > > > On Fri, Nov 11, 2022 at 12:58:28PM -0600, Limonciello, Mario wrote: > > > > > > > > > > > > > > > On 11/11/2022 11:41, Bjorn Helgaas wrote: > > > > > > > > > > > > > > > > On Mon, Oct 31, 2022 at 05:33:55PM -0500, Mario Limonciello wrote: > > > > > > > > > > > > > > > > > Firmware typically advertises that ACPI devices that represent PCIe > > > > > > > > > > > > > > > > > devices can support D3 by a combination of the value returned by > > > > > > > > > > > > > > > > > _S0W as well as the HotPlugSupportInD3 _DSD [1]. > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > `acpi_pci_bridge_d3` looks for this combination but also contains > > > > > > > > > > > > > > > > > an assumption that if an ACPI device contains power resources the PCIe > > > > > > > > > > > > > > > > > device it's associated with can support D3. This was introduced > > > > > > > > > > > > > > > > > from commit c6e331312ebf ("PCI/ACPI: Whitelist hotplug ports for > > > > > > > > > > > > > > > > > D3 if power managed by ACPI"). > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > > Some firmware configurations for "AMD Pink Sardine" do not support > > > > > > > > > > > > > > > > > wake from D3 in _S0W for the ACPI device representing the PCIe root > > > > > > > > > > > > > > > > > port used for tunneling. The PCIe device will still be opted into > > > > > > > > > > > > > > > > > runtime PM in the kernel [2] because of the logic within > > > > > > > > > > > > > > > > > `acpi_pci_bridge_d3`. This currently happens because the ACPI > > > > > > > > > > > > > > > > > device contains power resources. > > > > > > > > > > > > > > > > > > > > > > > > > > > > Wait. Is this as simple as just recognizing that: > > > > > > > > > > > > > > > > > > > > > > > > > > > > _PS0 means the OS has a knob to put the device in D0, but it doesn't > > > > > > > > > > > > > > mean the device can wake itself from a low-power state. The OS has > > > > > > > > > > > > > > to use _S0W to learn the device's ability to wake itself. > > > > > > > > > > > > > > > > > > > > > > > > > > It is. > > > > > > > > > > > > > > > > > > > > > > > > Now I'm confused again about what "HotPlugSupportInD3" means. The MS > > > > > > > > > > > > web page [1] says it identifies Root Ports capable of handling hot > > > > > > > > > > > > plug events while in D3. That sounds kind of related to _S0W: If _S0W > > > > > > > > > > > > says "I can wake myself from D3hot and D3cold", how is that different > > > > > > > > > > > > from "I can handle hotplug events in D3"? > > > > > > > > > > > > > > > > > > > > > > For native PME/hot-plug signaling there is no difference. This is the > > > > > > > > > > > same interrupt by the spec after all IIRC. > > > > > > > > > > > > > > > > > > > > > > For GPE-based signaling, though, there is a difference, because GPEs > > > > > > > > > > > can only be used directly for wake signaling (this is related to > > > > > > > > > > > _PRW). In particular, the only provision in the ACPI spec for device > > > > > > > > > > > hot-add are the Bus Check and Device Check notification values (0 and > > > > > > > > > > > 1) which require AML to run and evaluate Notify() on specific AML > > > > > > > > > > > objects. > > > > > > > > > > > > > > > > > > > > > > Hence, there is no spec-defined way to tell the OS that "something can > > > > > > > > > > > be hot-added under this device while in D3 and you will get notified > > > > > > > > > > > about that". > > > > > > > > > > > > > > > > > > > > So I guess acpi_pci_bridge_d3() looks for: > > > > > > > > > > > > > > > > > > > > - "wake signaling while in D3" (_S0W) and > > > > > > > > > > - "notification of hotplug while in D3" ("HotPlugSupportInD3") > > > > > > > > > > > > > > > > > > > > For Root Ports with both those abilities (or bridges below such Root > > > > > > > > > > Ports), we allow D3, and this patch doesn't change that. > > > > > > > > > > > > > > > > > > > > What this patch *does* change is that all bridges with _PS0 or _PR0 > > > > > > > > > > previously could use D3, but now will only be able to use D3 if they > > > > > > > > > > are also (or are below) a Root Port that can signal wakeup > > > > > > > > > > (wakeup.flags.valid) and can wakeup from D3hot or D3cold (_S0W). > > > > > > > > > > > > > > > > > > > > And this fixes the Pink Sardine because it has Root Ports that do > > > > > > > > > > Thunderbolt tunneling, and they have _PS0 or _PR0 but their _S0W says > > > > > > > > > > they cannot wake from D3. Previously we put those in D3, but they > > > > > > > > > > couldn't wake up. Now we won't put them in D3. > > > > > > > > > > > > > > > > > > > > I guess there's a possibility that this could break or cause higher > > > > > > > > > > power consumption on systems that were fixed by c6e331312ebf > > > > > > > > > > ("PCI/ACPI: Whitelist hotplug ports for D3 if power managed by ACPI"). > > > > > > > > > > I don't know enough about that scenario. Maybe Lukas will chime in. > > > > > > > > > > > > > > > > > > Well, it is possible that some of these systems will be affected. > > > > > > > > > > > > > > > > > > One of such cases is when the port in question has _S0W which says > > > > > > > > > that wakeup from D3 is not supported. In that case I think the kernel > > > > > > > > > should honor the _S0W input, because there may be a good reason known > > > > > > > > > to the platform integrator for it. > > > > > > > > > > > > > > > > > > The other case is when wakeup.flags.valid is unset for the port's ACPI > > > > > > > > > companion which means that the port cannot signal wakeup through > > > > > > > > > ACPI-related means at all and this may be problematic, especially in > > > > > > > > > the system-wide suspend case in which the wakeup capability is not too > > > > > > > > > relevant unless there is a system wakeup device under the port. > > > > > > > > > > > > > > > > > > I don't think that the adev->wakeup.flags.valid check has any bearing > > > > > > > > > on the _S0W check - if there is _S0W and it says "no wakeup from D3", > > > > > > > > > it should still be taken into account - so that check can be moved > > > > > > > > > past the _S0W check. > > > > > > > > > > > > > > > > So if _S0W says it can wake from D3, but wakeup.flags is not valid, > > > > > > > > it's still OK to use D3? > > > > > > > > > > > > > > No, it isn't, as per the code today and I don't think that this > > > > > > > particular part should be changed now. > > > > > > > > > > > > But the current upstream code checks acpi_pci_power_manageable(dev) > > > > > > first, so if "dev" has _PR0 or _PS0, we'll use D3 even if _S0W says it > > > > > > can wake from D3 and wakeup.flags is not valid. > > > > > > > > > > Yes, the current code will return 'true' if _PR0 or _PS0 is present > > > > > for dev regardless of anything else. > > > > > > > > > > The proposed change is to make that conditional on whether or not _S0W > > > > > for the root port says that wakeup from D3 is supported (or it is not > > > > > present or unusable). > > > > > > > > > > I see that I've missed one point now which is when the root port > > > > > doesn't have an ACPI companion, in which case we should go straight > > > > > for the "dev is power manageable" check. > > > > > > > > Moreover, it is possible that the bridge passed to acpi_pci_bridge_d3() has its > > > > own _S0W or a wakeup GPE if it is power-manageable via ACPI. In those cases > > > > it is not necessary to ask the Root Port's _S0W about wakeup from D3, so overall > > > > I would go for the patch like the below (not really tested). > > > > > > > > This works in the same way as the current code (unless I have missed anything) > > > > except for the case when the "target" bridge is power-manageable via ACPI, but > > > > it cannot signal wakeup via ACPI and has no _S0W. In that case it will consult > > > > the upstream Root Port's _S0W to check whether or not wakeup from D3 is > > > > supported. > > > > > > > > [Note that if dev_has_acpi_pm is 'true', it is kind of pointless to look for the > > > > "HotPlugSupportInD3" property of the Root Port, because the function is going to > > > > return 'true' regardless, but I'm not sure if adding an extra if () for handling > > > > this particular case is worth the hassle.] > > > > > > I think this has a lot of potential. I haven't tried it, but I wonder > > > if splitting out the Root Port-specific parts to a separate function > > > would be helpful, if only to make it more obvious that there may be > > > two different devices involved. > > > > > > If there are two devices ("dev" is a bridge below a Root Port), I > > > guess support in the Root Port is not necessarily required? E.g., > > > could "dev" assert a wakeup GPE that's not routed through the Root > > > Port? If Root Port support *is* required, maybe it would read more > > > clearly to test that first, before looking at the downstream device. > > > > Sorry for the delay. > > > > I don't really think that Root Port support is required for a bridge below > > a Root Port if that bridge itself is power-manageable via ACPI. Moreover, > > I don't think that the _S0W of a Root Port has any bearing on devices below > > it that have their own _S0W. > > > > So what we really want appears to be to evaluate _S0W for the target bridge, > > regardless of whether or not it is a Root Port, and return 'false' if that > > produces D2 or a shallower power state. Otherwise, we can do what we've > > done so far. > > > > The patch below implements, this - please let me know what you think. > > > > And here's a v2 with somewhat less code duplication. I'm wondering if you have any comments on this one? > --- > From: Rafael J. Wysocki > Subject: [PATCH] PCI / ACPI: PM: Take _S0W of the target bridge into account in acpi_pci_bridge_d3(() > > It is generally questionable to allow a PCI bridge to go into D3 if > it has _S0W returning D2 or a shallower power state, so modify > acpi_pci_bridge_d3(() to always take the return value of _S0W for the > target bridge into accout. That is, make it return 'false' if _S0W > returns D2 or a shallower power state for the target bridge regardless > of its ancestor PCIe Root Port properties. Of course, this also causes > 'false' to be returned if the PCIe Root Port itself is the target and > its _S0W returns D2 or a shallower power state. > > However, still allow bridges without _S0W that are power-manageable via > ACPI to enter D3 to retain the current code behavior in that case. > > Reported-by: Mario Limonciello > Signed-off-by: Rafael J. Wysocki > --- > drivers/acpi/device_pm.c | 16 ++++++++++++++++ > drivers/pci/pci-acpi.c | 34 ++++++++++++++++++++++++---------- > include/acpi/acpi_bus.h | 1 + > 3 files changed, 41 insertions(+), 10 deletions(-) > > Index: linux-pm/drivers/pci/pci-acpi.c > =================================================================== > --- linux-pm.orig/drivers/pci/pci-acpi.c > +++ linux-pm/drivers/pci/pci-acpi.c > @@ -977,22 +977,37 @@ bool acpi_pci_bridge_d3(struct pci_dev * > { > struct pci_dev *rpdev; > struct acpi_device *adev; > - acpi_status status; > - unsigned long long state; > const union acpi_object *obj; > > if (acpi_pci_disabled || !dev->is_hotplug_bridge) > return false; > > - /* Assume D3 support if the bridge is power-manageable by ACPI. */ > - if (acpi_pci_power_manageable(dev)) > - return true; > + adev = ACPI_COMPANION(&dev->dev); > + if (adev) { > + /* > + * If the bridge has _S0W, whether or not it can go into D3 > + * depends on what is returned by that object. In particular, > + * if the power state returned by _S0W is D2 or shallower, > + * entering D3 should not be allowed. > + */ > + if (acpi_dev_no_wakeup_from_d3(adev)) > + return false; > + > + /* > + * Otherwise, assume that the bridge can enter D3 so long as it > + * is power-manageable via ACPI. > + */ > + if (acpi_device_power_manageable(adev)) > + return true; > + } > > rpdev = pcie_find_root_port(dev); > if (!rpdev) > return false; > > - adev = ACPI_COMPANION(&rpdev->dev); > + if (rpdev != dev) > + adev = ACPI_COMPANION(&rpdev->dev); > + > if (!adev) > return false; > > @@ -1005,11 +1020,10 @@ bool acpi_pci_bridge_d3(struct pci_dev * > return false; > > /* > - * If the Root Port cannot wake itself from D3hot or D3cold, we > - * can't use D3. > + * In the bridge-below-a-Root-Port case, evaluate _S0W for the Root Port > + * to verify whether or not it can signal wakeup from D3. > */ > - status = acpi_evaluate_integer(adev->handle, "_S0W", NULL, &state); > - if (ACPI_SUCCESS(status) && state < ACPI_STATE_D3_HOT) > + if (rpdev != dev && acpi_dev_no_wakeup_from_d3(adev)) > return false; > > /* > Index: linux-pm/drivers/acpi/device_pm.c > =================================================================== > --- linux-pm.orig/drivers/acpi/device_pm.c > +++ linux-pm/drivers/acpi/device_pm.c > @@ -484,6 +484,22 @@ void acpi_dev_power_up_children_with_adr > acpi_dev_for_each_child(adev, acpi_power_up_if_adr_present, NULL); > } > > +/** > + * acpi_dev_no_wakeup_from_d3 - Check if wakeup signaling from D3 is supported > + * @adev: ACPI companion of the target device. > + * > + * Evaluate _S0W for @adev and return 'true' if it is successful and the power > + * state returned by it is D2 or shallower. > + */ > +bool acpi_dev_no_wakeup_from_d3(struct acpi_device *adev) > +{ > + unsigned long long state; > + acpi_status status; > + > + status = acpi_evaluate_integer(adev->handle, "_S0W", NULL, &state); > + return ACPI_SUCCESS(status) && state < ACPI_STATE_D3_HOT; > +} > + > #ifdef CONFIG_PM > static DEFINE_MUTEX(acpi_pm_notifier_lock); > static DEFINE_MUTEX(acpi_pm_notifier_install_lock); > Index: linux-pm/include/acpi/acpi_bus.h > =================================================================== > --- linux-pm.orig/include/acpi/acpi_bus.h > +++ linux-pm/include/acpi/acpi_bus.h > @@ -533,6 +533,7 @@ int acpi_bus_update_power(acpi_handle ha > int acpi_device_update_power(struct acpi_device *device, int *state_p); > bool acpi_bus_power_manageable(acpi_handle handle); > void acpi_dev_power_up_children_with_adr(struct acpi_device *adev); > +bool acpi_dev_no_wakeup_from_d3(struct acpi_device *adev); > int acpi_device_power_add_dependent(struct acpi_device *adev, > struct device *dev); > void acpi_device_power_remove_dependent(struct acpi_device *adev, > > > >