Received: by 2002:a05:7412:31a9:b0:e2:908c:2ebd with SMTP id et41csp2780555rdb; Tue, 12 Sep 2023 11:50:41 -0700 (PDT) X-Google-Smtp-Source: AGHT+IEVdgJRHBL7SjcPMCweDG7NIu3B7sznQDYVLQq4wnthGNs5CKGtq58v9h8pvMv40j4X+2js X-Received: by 2002:a05:6870:171e:b0:1b3:eec8:fa90 with SMTP id h30-20020a056870171e00b001b3eec8fa90mr416327oae.6.1694544641267; Tue, 12 Sep 2023 11:50:41 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1694544641; cv=none; d=google.com; s=arc-20160816; b=qH+zGUD9IlGbwBIGxOg/u8UWB//DcRelY+f9tJ+HA1K9nTS0TA8tMd1UcOOVSykpUs FNCx5RoU3An0uLARh56i/jvBroR+ckRYGtgQm6FD2o65ZDIRiAIXf6WtY9M1lBofkwLa 722yaAsGUOlkdaqiBX5uanHuAYCxcFKrsnKSRtiEa/4grPNpnyUFLfDxtZO1c6cC2kYn 9qvo1EuW4Y6XULtRqAGsRJ4RCkFK+2OIsjj1lrTEpMPqMWVrfkoj26gRjH8qGSlfqB4H +U8wpYJyCngVet10S8rqD6etOrKRmCuI/lttpqmM0TV+KtCCm38/MOADjjlyWvNyEJmz /q4A== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=tGRA61hoGgoCFS0D40TvlDdgqANLMKxkwjDplss986k=; fh=TcRPROXzT9svfC8PL4GA9v01BlJpZsrjV4HRPcpqUxk=; b=l9ChvYjJapOsHv1HhHgbqeNgIsT4ZHMF6NbAilbZnOEjEM39oFQUfr4y5k8gAlkVLi yd1JtnomktGl1BLgrjytpU1b8uwWqgsd/ALp8UHSYrHhZqCOmMLPXp2IqF65MKWoXe2R HcWNFrIDUF6C0RUCjT0zBlN95nTfAMM7u3fhQy4HWJYzw7tLRqMkexat+ne3v+N+EBpL itFOfOLsyvTp5Uo1M1NBRGo0FVmec5432atrUVFqDY4D5IxrC460pcFYAGZUK5rWBPfI i1CnHzTiP4KrIF7ZEkrR2u7kRvJkndphvTLAtCwR9/Ja2HsrrimhgZWITbX7qVILe6Rv 4bkA== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.35 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from groat.vger.email (groat.vger.email. [23.128.96.35]) by mx.google.com with ESMTPS id u16-20020a656710000000b005703b492a23si8434208pgf.308.2023.09.12.11.50.36 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 12 Sep 2023 11:50:41 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.35 as permitted sender) client-ip=23.128.96.35; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 23.128.96.35 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by groat.vger.email (Postfix) with ESMTP id AB0F48269F2B; Tue, 12 Sep 2023 11:48:28 -0700 (PDT) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.10 at groat.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S237701AbjILSsR (ORCPT + 99 others); Tue, 12 Sep 2023 14:48:17 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:41264 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S237610AbjILSry (ORCPT ); Tue, 12 Sep 2023 14:47:54 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id C988A1725; Tue, 12 Sep 2023 11:47:46 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id cd625864ca82de2a; Tue, 12 Sep 2023 20:47:45 +0200 Authentication-Results: v370.home.net.pl; spf=softfail (domain owner discourages use of this host) smtp.mailfrom=rjwysocki.net (client-ip=195.136.19.94; helo=[195.136.19.94]; envelope-from=rjw@rjwysocki.net; receiver=) Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by v370.home.net.pl (Postfix) with ESMTPSA id C09AD663BE5; Tue, 12 Sep 2023 20:47:44 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux ACPI Cc: LKML , Linux PM , Zhang Rui , Srinivas Pandruvada , Daniel Lezcano Subject: [PATCH v1 1/9] ACPI: thermal: Simplify initialization of critical and hot trips Date: Tue, 12 Sep 2023 20:35:40 +0200 Message-ID: <4858652.31r3eYUQgx@kreacher> In-Reply-To: <5708760.DvuYhMxLoT@kreacher> References: <5708760.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudeiiedgudeftdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffogffrnfdpggftiffpkfenuceurghilhhouhhtmecuudehtdenucesvcftvggtihhpihgvnhhtshculddquddttddmnecujfgurhephffvvefufffkjghfggfgtgesthfuredttddtjeenucfhrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqeenucggtffrrghtthgvrhhnpedvffeuiedtgfdvtddugeeujedtffetteegfeekffdvfedttddtuefhgeefvdejhfenucfkphepudelhedrudefiedrudelrdelgeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpeduleehrddufeeirdduledrleegpdhhvghlohepkhhrvggrtghhvghrrdhlohgtrghlnhgvthdpmhgrihhlfhhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqrggtphhisehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheplhhinhhugidqphhmsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprhhuihdriihhrghnghesihhnthgvlhdrtghomhdprhgtphhtthhopehs rhhinhhivhgrshdrphgrnhgurhhuvhgruggrsehlihhnuhigrdhinhhtvghlrdgtohhmpdhrtghpthhtohepuggrnhhivghlrdhlvgiitggrnhhosehlihhnrghrohdrohhrgh X-DCC--Metrics: v370.home.net.pl 1024; Body=6 Fuz1=6 Fuz2=6 Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (groat.vger.email [0.0.0.0]); Tue, 12 Sep 2023 11:48:28 -0700 (PDT) X-Spam-Status: No, score=-0.8 required=5.0 tests=HEADER_FROM_DIFFERENT_DOMAINS, MAILING_LIST_MULTI,SPF_HELO_NONE,SPF_PASS autolearn=unavailable autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on groat.vger.email From: Rafael J. Wysocki Use the observation that the critical and hot trip points are never updated by the ACPI thermal driver, because the flags passed from acpi_thermal_notify() to acpi_thermal_trips_update() do not include ACPI_TRIPS_CRITICAL or ACPI_TRIPS_HOT, to move the initialization of those trip points directly into acpi_thermal_get_trip_points() and reduce the size of __acpi_thermal_trips_update(). Also make the critical and hot trip points initialization code more straightforward and drop the flags that are not needed any more. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal.c | 130 ++++++++++++++++++++++++------------------------- 1 file changed, 66 insertions(+), 64 deletions(-) Index: linux-pm/drivers/acpi/thermal.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal.c +++ linux-pm/drivers/acpi/thermal.c @@ -43,17 +43,13 @@ #define ACPI_THERMAL_MAX_ACTIVE 10 #define ACPI_THERMAL_MAX_LIMIT_STR_LEN 65 -#define ACPI_TRIPS_CRITICAL BIT(0) -#define ACPI_TRIPS_HOT BIT(1) -#define ACPI_TRIPS_PASSIVE BIT(2) -#define ACPI_TRIPS_ACTIVE BIT(3) -#define ACPI_TRIPS_DEVICES BIT(4) +#define ACPI_TRIPS_PASSIVE BIT(0) +#define ACPI_TRIPS_ACTIVE BIT(1) +#define ACPI_TRIPS_DEVICES BIT(2) #define ACPI_TRIPS_THRESHOLDS (ACPI_TRIPS_PASSIVE | ACPI_TRIPS_ACTIVE) -#define ACPI_TRIPS_INIT (ACPI_TRIPS_CRITICAL | ACPI_TRIPS_HOT | \ - ACPI_TRIPS_PASSIVE | ACPI_TRIPS_ACTIVE | \ - ACPI_TRIPS_DEVICES) +#define ACPI_TRIPS_INIT (ACPI_TRIPS_THRESHOLDS | ACPI_TRIPS_DEVICES) /* * This exception is thrown out in two cases: @@ -196,62 +192,6 @@ static void __acpi_thermal_trips_update( bool valid = false; int i; - /* Critical Shutdown */ - if (flag & ACPI_TRIPS_CRITICAL) { - status = acpi_evaluate_integer(tz->device->handle, "_CRT", NULL, &tmp); - tz->trips.critical.temperature = tmp; - /* - * Treat freezing temperatures as invalid as well; some - * BIOSes return really low values and cause reboots at startup. - * Below zero (Celsius) values clearly aren't right for sure.. - * ... so lets discard those as invalid. - */ - if (ACPI_FAILURE(status)) { - tz->trips.critical.valid = false; - acpi_handle_debug(tz->device->handle, - "No critical threshold\n"); - } else if (tmp <= 2732) { - pr_info(FW_BUG "Invalid critical threshold (%llu)\n", tmp); - tz->trips.critical.valid = false; - } else { - tz->trips.critical.valid = true; - acpi_handle_debug(tz->device->handle, - "Found critical threshold [%lu]\n", - tz->trips.critical.temperature); - } - if (tz->trips.critical.valid) { - if (crt == -1) { - tz->trips.critical.valid = false; - } else if (crt > 0) { - unsigned long crt_k = celsius_to_deci_kelvin(crt); - - /* - * Allow override critical threshold - */ - if (crt_k > tz->trips.critical.temperature) - pr_info("Critical threshold %d C\n", crt); - - tz->trips.critical.temperature = crt_k; - } - } - } - - /* Critical Sleep (optional) */ - if (flag & ACPI_TRIPS_HOT) { - status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); - if (ACPI_FAILURE(status)) { - tz->trips.hot.valid = false; - acpi_handle_debug(tz->device->handle, - "No hot threshold\n"); - } else { - tz->trips.hot.temperature = tmp; - tz->trips.hot.valid = true; - acpi_handle_debug(tz->device->handle, - "Found hot threshold [%lu]\n", - tz->trips.hot.temperature); - } - } - /* Passive (optional) */ if (((flag & ACPI_TRIPS_PASSIVE) && tz->trips.passive.trip.valid) || flag == ACPI_TRIPS_INIT) { @@ -451,11 +391,73 @@ static void acpi_thermal_trips_update(st dev_name(&adev->dev), event, 0); } +static void acpi_thermal_get_critical_trip(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + + if (crt > 0) { + tmp = celsius_to_deci_kelvin(crt); + goto set; + } + if (crt == -1) { + acpi_handle_debug(tz->device->handle, "Critical threshold disabled\n"); + goto fail; + } + + status = acpi_evaluate_integer(tz->device->handle, "_CRT", NULL, &tmp); + if (ACPI_FAILURE(status)) { + acpi_handle_debug(tz->device->handle, "No critical threshold\n"); + goto fail; + } + if (tmp <= 2732) { + /* + * Below zero (Celsius) values clearly aren't right for sure, + * so discard them as invalid. + */ + pr_info(FW_BUG "Invalid critical threshold (%llu)\n", tmp); + goto fail; + } + +set: + tz->trips.critical.valid = true; + tz->trips.critical.temperature = tmp; + acpi_handle_debug(tz->device->handle, "Critical threshold [%lu]\n", + tz->trips.critical.temperature); + return; + +fail: + tz->trips.critical.valid = false; + tz->trips.critical.temperature = THERMAL_TEMP_INVALID; +} + +static void acpi_thermal_get_hot_trip(struct acpi_thermal *tz) +{ + unsigned long long tmp; + acpi_status status; + + status = acpi_evaluate_integer(tz->device->handle, "_HOT", NULL, &tmp); + if (ACPI_FAILURE(status)) { + tz->trips.hot.valid = false; + tz->trips.hot.temperature = THERMAL_TEMP_INVALID; + acpi_handle_debug(tz->device->handle, "No hot threshold\n"); + return; + } + + tz->trips.hot.valid = true; + tz->trips.hot.temperature = tmp; + acpi_handle_debug(tz->device->handle, "Hot threshold [%lu]\n", + tz->trips.hot.temperature); +} + static int acpi_thermal_get_trip_points(struct acpi_thermal *tz) { bool valid; int i; + acpi_thermal_get_critical_trip(tz); + acpi_thermal_get_hot_trip(tz); + /* Passive and active trip points (optional). */ __acpi_thermal_trips_update(tz, ACPI_TRIPS_INIT); valid = tz->trips.critical.valid |