Received: by 2002:a05:7412:d8a:b0:e2:908c:2ebd with SMTP id b10csp3390806rdg; Tue, 17 Oct 2023 13:13:14 -0700 (PDT) X-Google-Smtp-Source: AGHT+IHiD/UAGIuDJ9tfovWYuhhWSnxtNrX1WZVW4QoaB3jXV9NeWTT4JzYXPUeU42EM0Uzmam5P X-Received: by 2002:a05:6a00:134b:b0:68f:cbd3:5b01 with SMTP id k11-20020a056a00134b00b0068fcbd35b01mr5205593pfu.13.1697573593760; Tue, 17 Oct 2023 13:13:13 -0700 (PDT) ARC-Seal: i=1; a=rsa-sha256; t=1697573593; cv=none; d=google.com; s=arc-20160816; b=zEziIppyp7m3FX0VpF+w2K8/ICkEU6LyOquRM2Iumx87hp/sdmFg0k6qxifUcNiNkp rp1m7ZHqmqSdjZxWDwPLwAde4rJ6bpbdLW0OR1NUBbuVT+znqYzzmKk8j778pkaj6sMb fIOQjo3RpHYBCLj5EYLDvvO7WgZXF1elL3RVbEx0jkh9pZZWDHGrxH3R3xUTbn58bXXx e1TSWYbP8ev0cENxEAEUXeY7vCcEgi+7mE/wbkDhNgfHCMrbmar/21fPadD7KQbNWJR2 89ZKPOIZBeQkKLTbPsgbgpZNW7F5+GVR99lTPvs1ve5d6p9UgWXE/35+wntlvbleiZ6g 23eQ== ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=list-id:precedence:content-transfer-encoding:mime-version :references:in-reply-to:message-id:date:subject:cc:to:from; bh=H+6oC/lwpHa+eL8Pa1czoLxgL9AOgeUcSP1wb+UviAE=; fh=p/Yd/06WV/NRg/vf6gGQsBGSNtCRQ5gqTvI3QmryL7M=; b=hgZqNLjKUaQkJfH6fzvSS5Mm+qsDpz5jvc4gnpSSud8EIUDnnXtzr4XQRtYWW16Y0u HyrD3zWsc6NDlbaGfbFOnOGW5alXsOe7uCOFfAgYGqJ/Rdw042qY9bIXHqt+HZVT/4XM AYWPMl2QsJR0muRFlcIHpT1+MX/H6fdTweBMqvwmlUEnh8qBPSF3/V9gWozRsuZ1RpaS r42wB1Oj/APDb2vCbkcCbSE8BixlBzSQ2kB64ppl0bVsGMDwCOn5YxnOQFw6IPT+de+l hG3Iw+s+noEjvZHz8p8Kp0CvmTVLqHgRvuIRvO9VRq89Tr2h/lN1BhW0U/uhnFFgk0OY vZJQ== ARC-Authentication-Results: i=1; mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:6 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Return-Path: Received: from pete.vger.email (pete.vger.email. [2620:137:e000::3:6]) by mx.google.com with ESMTPS id h21-20020a056a00219500b006be1a0457d9si2045326pfi.10.2023.10.17.13.13.13 (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Tue, 17 Oct 2023 13:13:13 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:6 as permitted sender) client-ip=2620:137:e000::3:6; Authentication-Results: mx.google.com; spf=pass (google.com: domain of linux-kernel-owner@vger.kernel.org designates 2620:137:e000::3:6 as permitted sender) smtp.mailfrom=linux-kernel-owner@vger.kernel.org Received: from out1.vger.email (depot.vger.email [IPv6:2620:137:e000::3:0]) by pete.vger.email (Postfix) with ESMTP id BDA7F8028555; Tue, 17 Oct 2023 13:13:07 -0700 (PDT) X-Virus-Status: Clean X-Virus-Scanned: clamav-milter 0.103.10 at pete.vger.email Received: (majordomo@vger.kernel.org) by vger.kernel.org via listexpand id S1343689AbjJQUMu (ORCPT + 99 others); Tue, 17 Oct 2023 16:12:50 -0400 Received: from lindbergh.monkeyblade.net ([23.128.96.19]:33148 "EHLO lindbergh.monkeyblade.net" rhost-flags-OK-OK-OK-OK) by vger.kernel.org with ESMTP id S231478AbjJQUMs (ORCPT ); Tue, 17 Oct 2023 16:12:48 -0400 Received: from cloudserver094114.home.pl (cloudserver094114.home.pl [79.96.170.134]) by lindbergh.monkeyblade.net (Postfix) with ESMTPS id C58156FAA; Tue, 17 Oct 2023 13:12:45 -0700 (PDT) Received: from localhost (127.0.0.1) (HELO v370.home.net.pl) by /usr/run/smtp (/usr/run/postfix/private/idea_relay_lmtp) via UNIX with SMTP (IdeaSmtpServer 5.2.0) id b9b0ec6ca16d320a; Tue, 17 Oct 2023 22:12:44 +0200 Received: from kreacher.localnet (unknown [195.136.19.94]) (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits) key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256) (No client certificate requested) by cloudserver094114.home.pl (Postfix) with ESMTPSA id 7ACE7666BCD; Tue, 17 Oct 2023 22:12:43 +0200 (CEST) From: "Rafael J. Wysocki" To: Linux PM Cc: Linux ACPI , Daniel Lezcano , LKML , Srinivas Pandruvada , "Rafael J. Wysocki" , Zhang Rui Subject: [PATCH v1 2/3] ACPI: thermal_lib: Add functions returning temperature in deci-Kelvin Date: Tue, 17 Oct 2023 22:06:52 +0200 Message-ID: <4861460.GXAFRqVoOG@kreacher> In-Reply-To: <5740803.DvuYhMxLoT@kreacher> References: <5740803.DvuYhMxLoT@kreacher> MIME-Version: 1.0 Content-Transfer-Encoding: 7Bit Content-Type: text/plain; charset="UTF-8" X-CLIENT-IP: 195.136.19.94 X-CLIENT-HOSTNAME: 195.136.19.94 X-VADE-SPAMSTATE: clean X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvkedrjedvgddugeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffqoffgrffnpdggtffipffknecuuegrihhlohhuthemucduhedtnecusecvtfgvtghiphhivghnthhsucdlqddutddtmdenucfjughrpefhvfevufffkfgjfhgggfgtsehtufertddttdejnecuhfhrohhmpedftfgrfhgrvghlucflrdcuhgihshhotghkihdfuceorhhjfiesrhhjfiihshhotghkihdrnhgvtheqnecuggftrfgrthhtvghrnhepvdffueeitdfgvddtudegueejtdffteetgeefkeffvdeftddttdeuhfegfedvjefhnecukfhppeduleehrddufeeirdduledrleegnecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepudelhedrudefiedrudelrdelgedphhgvlhhopehkrhgvrggthhgvrhdrlhhotggrlhhnvghtpdhmrghilhhfrhhomhepfdftrghfrggvlhculfdrucghhihsohgtkhhifdcuoehrjhifsehrjhifhihsohgtkhhirdhnvghtqedpnhgspghrtghpthhtohepjedprhgtphhtthhopehlihhnuhigqdhpmhesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopehlihhnuhigqdgrtghpihesvhhgvghrrdhkvghrnhgvlhdrohhrghdprhgtphhtthhopegurghnihgvlhdrlhgviigtrghnoheslhhinhgrrhhordhorhhgpdhrtghpthhtoheplhhinhhugidqkhgvrhhnvghlsehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghp thhtohepshhrihhnihhvrghsrdhprghnughruhhvrggurgeslhhinhhugidrihhnthgvlhdrtghomhdprhgtphhtthhopehrrghfrggvlheskhgvrhhnvghlrdhorhhg X-DCC--Metrics: v370.home.net.pl 1024; Body=7 Fuz1=7 Fuz2=7 X-Spam-Status: No, score=-0.8 required=5.0 tests=HEADER_FROM_DIFFERENT_DOMAINS, MAILING_LIST_MULTI,SPF_HELO_NONE,SPF_PASS autolearn=unavailable autolearn_force=no version=3.4.6 X-Spam-Checker-Version: SpamAssassin 3.4.6 (2021-04-09) on pete.vger.email Precedence: bulk List-ID: X-Mailing-List: linux-kernel@vger.kernel.org X-Greylist: Sender passed SPF test, not delayed by milter-greylist-4.6.4 (pete.vger.email [0.0.0.0]); Tue, 17 Oct 2023 13:13:08 -0700 (PDT) From: Rafael J. Wysocki Because the ACPI thermal driver generally operates temperature values in deci-Kelvin, it needs the library functions returning temperature for various trip point types to use deci-Kelvin too. To address that, arrange the ACPI thermal library code in three levels of functions where the high-level ones will return temperature in milli-Celsius, as needed by the thermal core and the majority of thermal drivers, the mid-level ones will return temperature in deci-Kelvin and will be called internally by the corresponding high- level functions, and all of the mid-level functions will call the same low-level one, acpi_trip_temp(), to actually evaluate ACPI objects to retrieve themperature values from the platform firmware. Going forward, this will allow the ACPI thermal driver to use the mid-level functions to provide temperature values needed by it, so as to reduce code duplication related to evaluating trip temperature ACPI control methods. No intentional functional impact. Signed-off-by: Rafael J. Wysocki --- drivers/acpi/thermal_lib.c | 75 ++++++++++++++++++++++++++++++++++++--------- 1 file changed, 60 insertions(+), 15 deletions(-) Index: linux-pm/drivers/acpi/thermal_lib.c =================================================================== --- linux-pm.orig/drivers/acpi/thermal_lib.c +++ linux-pm/drivers/acpi/thermal_lib.c @@ -3,8 +3,8 @@ * Copyright 2023 Linaro Limited * Copyright 2023 Intel Corporation * - * Library routines for populating a generic thermal trip point structure - * with data obtained by evaluating a specific object in the ACPI Namespace. + * Library routines for retrieving trip point temperature values from the + * platform firmware via ACPI. */ #include #include @@ -17,11 +17,11 @@ * firmware. Any values out of these boundaries may be considered * bogus and we can assume the firmware has no data to provide. */ -#define TEMP_MIN_DECIK 2180 -#define TEMP_MAX_DECIK 4480 +#define TEMP_MIN_DECIK 2180ULL +#define TEMP_MAX_DECIK 4480ULL -static int thermal_acpi_trip_temp(struct acpi_device *adev, char *obj_name, - int *ret_temp) +static int acpi_trip_temp(struct acpi_device *adev, char *obj_name, + int *ret_temp) { unsigned long long temp; acpi_status status; @@ -33,7 +33,7 @@ static int thermal_acpi_trip_temp(struct } if (temp >= TEMP_MIN_DECIK && temp <= TEMP_MAX_DECIK) { - *ret_temp = deci_kelvin_to_millicelsius(temp); + *ret_temp = temp; } else { acpi_handle_debug(adev->handle, "%s result %llu out of range\n", obj_name, temp); @@ -43,6 +43,44 @@ static int thermal_acpi_trip_temp(struct return 0; } +int acpi_active_trip_temp(struct acpi_device *adev, int id, int *ret_temp) +{ + char obj_name[] = {'_', 'A', 'C', '0' + id, '\0'}; + + if (id < 0 || id > 9) + return -EINVAL; + + return acpi_trip_temp(adev, obj_name, ret_temp); +} + +int acpi_passive_trip_temp(struct acpi_device *adev, int *ret_temp) +{ + return acpi_trip_temp(adev, "_PSV", ret_temp); +} + +int acpi_hot_trip_temp(struct acpi_device *adev, int *ret_temp) +{ + return acpi_trip_temp(adev, "_HOT", ret_temp); +} + +int acpi_critical_trip_temp(struct acpi_device *adev, int *ret_temp) +{ + return acpi_trip_temp(adev, "_CRT", ret_temp); +} + +static int thermal_temp(int error, int temp_decik, int *ret_temp) +{ + if (error) + return error; + + if (temp_decik == THERMAL_TEMP_INVALID) + *ret_temp = THERMAL_TEMP_INVALID; + else + *ret_temp = deci_kelvin_to_millicelsius(temp_decik); + + return 0; +} + /** * thermal_acpi_active_trip_temp - Retrieve active trip point temperature * @adev: Target thermal zone ACPI device object. @@ -57,12 +95,10 @@ static int thermal_acpi_trip_temp(struct */ int thermal_acpi_active_trip_temp(struct acpi_device *adev, int id, int *ret_temp) { - char obj_name[] = {'_', 'A', 'C', '0' + id, '\0'}; - - if (id < 0 || id > 9) - return -EINVAL; + int temp_decik; + int ret = acpi_active_trip_temp(adev, id, &temp_decik); - return thermal_acpi_trip_temp(adev, obj_name, ret_temp); + return thermal_temp(ret, temp_decik, ret_temp); } EXPORT_SYMBOL_GPL(thermal_acpi_active_trip_temp); @@ -78,7 +114,10 @@ EXPORT_SYMBOL_GPL(thermal_acpi_active_tr */ int thermal_acpi_passive_trip_temp(struct acpi_device *adev, int *ret_temp) { - return thermal_acpi_trip_temp(adev, "_PSV", ret_temp); + int temp_decik; + int ret = acpi_passive_trip_temp(adev, &temp_decik); + + return thermal_temp(ret, temp_decik, ret_temp); } EXPORT_SYMBOL_GPL(thermal_acpi_passive_trip_temp); @@ -95,7 +134,10 @@ EXPORT_SYMBOL_GPL(thermal_acpi_passive_t */ int thermal_acpi_hot_trip_temp(struct acpi_device *adev, int *ret_temp) { - return thermal_acpi_trip_temp(adev, "_HOT", ret_temp); + int temp_decik; + int ret = acpi_hot_trip_temp(adev, &temp_decik); + + return thermal_temp(ret, temp_decik, ret_temp); } EXPORT_SYMBOL_GPL(thermal_acpi_hot_trip_temp); @@ -111,6 +153,9 @@ EXPORT_SYMBOL_GPL(thermal_acpi_hot_trip_ */ int thermal_acpi_critical_trip_temp(struct acpi_device *adev, int *ret_temp) { - return thermal_acpi_trip_temp(adev, "_CRT", ret_temp); + int temp_decik; + int ret = acpi_critical_trip_temp(adev, &temp_decik); + + return thermal_temp(ret, temp_decik, ret_temp); } EXPORT_SYMBOL_GPL(thermal_acpi_critical_trip_temp);