Received: by 2002:ab2:7903:0:b0:1fb:b500:807b with SMTP id a3csp1004112lqj; Mon, 3 Jun 2024 07:32:19 -0700 (PDT) X-Forwarded-Encrypted: i=3; AJvYcCVBim35bZ6isyiSkjWrb0jM8GrcSIdeSw3RowIUXVO42BIsOb3olcl1kt5/4Bo5lZ6AokUV0tXEexc2IbIIXa9QsN9gAdaUjuyRvCUhCQ== X-Google-Smtp-Source: AGHT+IGVPj1J5CrUBH2x9vhOJccPyJ+JqYYJfnCF+SHX5OqfR6yE8bguNxHU6WT3dzdHOfKsC9hA X-Received: by 2002:ac8:5e54:0:b0:43f:efc6:53b0 with SMTP id d75a77b69052e-43ff5500535mr72630681cf.59.1717425138927; Mon, 03 Jun 2024 07:32:18 -0700 (PDT) ARC-Seal: i=2; a=rsa-sha256; t=1717425138; cv=pass; d=google.com; s=arc-20160816; b=JhSwyveRW9SFYbJ1HHfK0Rtve07lvoS+2medxgdl7HBjJECG1WWgJF98wVRE7TQ/6v Q6LccwHEaFmkI1T03ojqy/mC+NmPDiycP46O8BdCQeFR/wtgBpv4530UIC2N0rIZdpHc e+vfc/QEEcChlMD4wUBQ/iDq1qRpXYra3qQ6csGhoKJPfFwL2iCwdRMBFItejgG5y9mC My/nS31HPfcpV0+MAM+OVU7ab6XCob+sw9xcRAhIJi4Ju6+XMQKUd9EpidvtbPtrUGu0 gQwwfpr7Ar4RFL2KliXgpBy6TOEdYed/l45oZGl7PmgCvx/RClNBNg1qCttD17uULX+j kqlQ== ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816; h=reply-to:content-transfer-encoding:mime-version:list-unsubscribe :list-subscribe:list-id:precedence:references:in-reply-to:message-id :date:subject:cc:to:from:feedback-id:dkim-signature; bh=MX7bhPDpyoRoQtgN30Y8zQVJv0ZI59dtVj8MaYOZzjY=; fh=+yzEpLSiBvUidZIqtFInIHHfTuWGi7qn3VNTbmI+zrs=; b=MuXRaq2zqXaitSzvW1VX1cTEB25320y58Ucx2prTrNuX+TDHWyw0hQ3a0oslT5ne72 CPeqeCNEujrgCqvMBSkekmU+TA/p6fmNWCqS+eRZCAr4Wqz/xOL5sKcD79aKx5IHV3rz NA5l+3qkANZBxmNHkZ8ebc/z55DMwnHc5yf/79Md1DOAlRmCQ2ngIRzw1E1ruHBnlNPV VUlAYJZNzZMnFlkVsOo5oJTUAWnJrtLTOZwl0yYzeUkhyDO+jGLmFmsgUHg9CdAf58Sx NUKfnlOK8+kLvD+7tz7mPs+vKWhHeJ90KatLDeJYAc9dRq8H/2Fg3jL68WVvmqAexDj2 vLIA==; dara=google.com ARC-Authentication-Results: i=2; mx.google.com; dkim=pass header.i=@carrierzone.com header.s=mailmia header.b=qvfoUrf8; arc=pass (i=1 dkim=pass dkdomain=carrierzone.com); spf=pass (google.com: domain of linux-wireless+bounces-8428-linux.lists.archive=gmail.com@vger.kernel.org designates 2604:1380:45d1:ec00::1 as permitted sender) smtp.mailfrom="linux-wireless+bounces-8428-linux.lists.archive=gmail.com@vger.kernel.org" Return-Path: Received: from ny.mirrors.kernel.org (ny.mirrors.kernel.org. [2604:1380:45d1:ec00::1]) by mx.google.com with ESMTPS id d75a77b69052e-43ff25c41a7si86516471cf.795.2024.06.03.07.32.18 for (version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256); Mon, 03 Jun 2024 07:32:18 -0700 (PDT) Received-SPF: pass (google.com: domain of linux-wireless+bounces-8428-linux.lists.archive=gmail.com@vger.kernel.org designates 2604:1380:45d1:ec00::1 as permitted sender) client-ip=2604:1380:45d1:ec00::1; Authentication-Results: mx.google.com; dkim=pass header.i=@carrierzone.com header.s=mailmia header.b=qvfoUrf8; arc=pass (i=1 dkim=pass dkdomain=carrierzone.com); spf=pass (google.com: domain of linux-wireless+bounces-8428-linux.lists.archive=gmail.com@vger.kernel.org designates 2604:1380:45d1:ec00::1 as permitted sender) smtp.mailfrom="linux-wireless+bounces-8428-linux.lists.archive=gmail.com@vger.kernel.org" Received: from smtp.subspace.kernel.org (wormhole.subspace.kernel.org [52.25.139.140]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by ny.mirrors.kernel.org (Postfix) with ESMTPS id 8F0081C208A0 for ; Mon, 3 Jun 2024 14:32:18 +0000 (UTC) Received: from localhost.localdomain (localhost.localdomain [127.0.0.1]) by smtp.subspace.kernel.org (Postfix) with ESMTP id BFB97757E0; Mon, 3 Jun 2024 14:32:17 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; dkim=pass (1024-bit key) header.d=carrierzone.com header.i=@carrierzone.com header.b="qvfoUrf8" X-Original-To: linux-wireless@vger.kernel.org Received: from mail33c25.carrierzone.com (mail33c25.carrierzone.com [64.29.147.43]) (using TLSv1.2 with cipher ECDHE-RSA-AES256-GCM-SHA384 (256/256 bits)) (No client certificate requested) by smtp.subspace.kernel.org (Postfix) with ESMTPS id 1192E57C9A for ; Mon, 3 Jun 2024 14:32:14 +0000 (UTC) Authentication-Results: smtp.subspace.kernel.org; arc=none smtp.client-ip=64.29.147.43 ARC-Seal:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1717425137; cv=none; b=NziX7yOJCqhmTOgpwBcNo35zS+PwAdhmCET79IIaH3fQs1foJSGtBH0/9Hk9A3Cye9hlnorISrGQOckSVJs10rGGxcgei+jf6rhIRSlbJHc9+bXVG8dgft+jkHaw+e0nv/8ss4eSoNBBb78llvSTynov2p8kggnsqsrpUh+Xs8w= ARC-Message-Signature:i=1; a=rsa-sha256; d=subspace.kernel.org; s=arc-20240116; t=1717425137; c=relaxed/simple; bh=MX7bhPDpyoRoQtgN30Y8zQVJv0ZI59dtVj8MaYOZzjY=; h=From:To:CC:Subject:Date:Message-ID:In-Reply-To:References: MIME-Version:Content-Type; b=XPcSQ72VaC85lG7H03CCdO/uEhYki+GWxZkrnBGHpPcEb1zCi0HifIhrf9wEhZQO64pPRH5P6dXjMUKcawpuDa3w4y++0HOBBCKnG8MXTapcXcLImVq9ia4js75qvWqZd4JRnKcbEQzICwWkCdcrrEZgp+QoBl4XGFzT54HWRm4= ARC-Authentication-Results:i=1; smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=hindutool.com; spf=none smtp.mailfrom=hindutool.com; dkim=pass (1024-bit key) header.d=carrierzone.com header.i=@carrierzone.com header.b=qvfoUrf8; arc=none smtp.client-ip=64.29.147.43 Authentication-Results: smtp.subspace.kernel.org; dmarc=none (p=none dis=none) header.from=hindutool.com Authentication-Results: smtp.subspace.kernel.org; spf=none smtp.mailfrom=hindutool.com DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=carrierzone.com; s=mailmia; t=1717423966; bh=MX7bhPDpyoRoQtgN30Y8zQVJv0ZI59dtVj8MaYOZzjY=; h=From:To:CC:Subject:Date:In-Reply-To:References:Reply-to:From; b=qvfoUrf8TdIjutwNlHndklo7yuXdHGfrFTGp9up3buPXorMSW07tLZD5HIejufeyr pOR3EG1HJWvkHQZ/2cMe+bluuLm0JaYKMcH5pgzfS4ahCWZ1mpO9bvVlXy8g9mkOTa KP8hEs9I2xhk4KFX5ldUrp1Plf9uPfjv+SFHqEfs= Feedback-ID:pgupta@hindutoo Received: from mail33c25.carrierzone.com (localhost [127.0.0.1]) by mail33c25.carrierzone.com (8.14.9/8.13.1) with ESMTP id 453ECfms013809 (version=TLSv1/SSLv3 cipher=ECDHE-RSA-AES256-GCM-SHA384 bits=256 verify=NO); Mon, 3 Jun 2024 14:12:41 +0000 Received: (from webmail@localhost) by mail33c25.carrierzone.com (8.14.9/8.12.2/Submit) id 453ECf3Y013729; Mon, 3 Jun 2024 10:12:41 -0400 From: "pgupta@hindutool.com" To: quic_vthiagar@quicinc.com, quic_hprem@quicinc.com, quic_jjohnson@quicinc.com, quic_bqiang@quicinc.com, ath12k@lists.infradead.org CC: linux-wireless@vger.kernel.org Subject: Re: [PATCH v7 0/8] wifi: ath12k: Introduce device group abstraction Date: Mon, 03 Jun 2024 10:12:41 -0400 Message-ID: <1717423961.zxh2nipscocc4sk0@mailapp03.register.com> In-Reply-To: <3453b0f2-6cf8-8377-127e-77f955593d3b@quicinc.com> References: <20240528063547.1400700-1-quic_hprem@quicinc.com> <396d645d-6f3b-4c1b-9d4b-d056fad36192@quicinc.com> <7b92a6cd-187d-4b6d-8cfb-af54365751fc@quicinc.com> <1717161560.nw3mokq68g8og484@mailapp03.register.com> <3453b0f2-6cf8-8377-127e-77f955593d3b@quicinc.com> Precedence: bulk X-Mailing-List: linux-wireless@vger.kernel.org List-Id: List-Subscribe: List-Unsubscribe: MIME-Version: 1.0 Content-Type: text/plain; charset=UTF-8 Content-Transfer-Encoding: quoted-printable X-Image-Url: https://mailapp03.register.com/api/storage/pgupta@hindutool.com/profile/picture Reply-to: pgupta@hindutool.com X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 40 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedvledrvdelvddgjeefucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecujffquffvqffrkfetpdfqfgfvpdfgpfggqdevvdehnecuuegrihhlohhuthemuceftddunecuogfuohhrthgvugftvggtihhpvdculdegtddmnecujfgurhephffvvefufffkjghfgggtgfhrsehtqhertddttdejnecuhfhrohhmpedfphhguhhpthgrsehhihhnughuthhoohhlrdgtohhmfdcuoehpghhuphhtrgeshhhinhguuhhtohholhdrtghomheqnecuggftrfgrthhtvghrnheptedtvdeiteekgeduheeitefhueekheetffethfdvjeffieejvdevvedvtedvgeehnecukfhppeduvdejrddtrddtrddunecuvehluhhsthgvrhfuihiivgeptdenucfrrghrrghmpehinhgvthepuddvjedrtddrtddruddphhgvlhhopehmrghilheffegtvdehrdgtrghrrhhivghriihonhgvrdgtohhmpdhmrghilhhfrhhomhepphhguhhpthgrsehhihhnughuthhoohhlrdgtohhmpdhnsggprhgtphhtthhopeeipdhrtghpthhtoheplhhinhhugidqfihirhgvlhgvshhssehvghgvrhdrkhgvrhhnvghlrdhorhhgpdhrtghpthhtoheprghthhduvdhksehlihhsthhsrdhinhhfrhgruggvrggurdhorhhgpdhrtghpthhtohepqhhuihgtpggsqhhirghnghesqhhuihgtihhntgdrtghomhdprhgtphhtthhopehquhhitggpjhhjohhhnhhsohhnsehquhhitghinhgtrdgtohhmpdhrtgh! pthhtohepqhhuihgtpghhphhrvghmsehquhhitghinhgtrdgtohhmpdhrtghpthhtohepqhhuihgtpghvthhhihgrghgrrhesqhhuihgtihhntgdrtghomh X-Rspamd-Result: default: False [0.90 / 6.00]; FROM_DN_EQ_ADDR(1.00)[]; MIME_GOOD(-0.10)[text/plain]; REPLYTO_ADDR_EQ_FROM(0.00)[]; MISSING_XM_UA(0.00)[]; RCVD_COUNT_ONE(0.00)[1]; MIME_TRACE(0.00)[0:+]; FROM_EQ_ENVFROM(0.00)[]; ARC_NA(0.00)[]; RCVD_TLS_LAST(0.00)[]; HAS_REPLYTO(0.00)[pgupta@hindutool.com]; TO_DN_NONE(0.00)[]; TO_MATCH_ENVRCPT_ALL(0.00)[]; RCPT_COUNT_FIVE(0.00)[6] X-Rspamd-Status: No, score=0.90 X-Origin-Country: Unknown Thank you for your reply. I have passed this information along to my board = manufacturer (Compex) and we are currently working on a solution for the at= h12k failing to recognize my module in the board-2.bin Prashant On Mon, 3 Jun 2024 10:33:09 +0530, Vasanthakumar Thiagarajan wrote: >> On 5/31/2024 6:49 PM, pgupta@hindutool.com wrote: >> > Is there a limit to the number of hardware abstraction layers? >> >> Please note that grouping multiple hardware under one wiphy is still not= supported in >> ath12k. This patch series is a strep towards such architecture. When the= full hardware >> grouping support is added, there will not be any restrictions in the num= ber of hardware >> which can be be grouped under only wiphy. >> >> My current platform has 3 physical WiFi 7 modules in one machine - one f= or each >> frequency 2.4 GHz, 5 GHz, and 6GHz. Is this currently not supported? >> >> This should work with ath12k as all three will be registered as three di= fferent wiphys. >> >> > What if I want to connect more than 3 modules including identical modu= les of the same frequency? My setup will not be utilizing combined frequenc= y modules. >> >> Grouping hardware having same frequency capability will make things very= complex, I dont >> think it is worthy of the effort especially there is no obvious real use= case to combine >> such radios under one wiphy. >> >> > FYI, in my platform, each module is connected to its own PCIe slot, an= d has its own antennas so I assume it would be recognized as its own wirele= ss device by the OS (i.e wlan0, wlan1, wlan2, etc.). >> > >> >> Yes, each hardware will be registered as separate phy and wlan >> interfaces with respective capability can be created on top of >> them. >> >> Vasanth >> >> >> > >> > On Fri, 31 May 2024 15:35:24 +0530, Harshitha Prem wrote: >> > >> >>> On 5/30/2024 3:58 AM, Jeff Johnson wrote: >> >>>> On 5/28/2024 8:13 PM, Baochen Qiang wrote: >> >>>>> >> >>>>> >> >>>>> On 5/29/2024 6:04 AM, Jeff Johnson wrote: >> >>>>>> On 5/27/2024 11:35 PM, Harshitha Prem wrote: >> >>>>>>> To support multi-link operation, multiple devices with different= bands say >> >>>>>>> 2 GHz or 5 GHz or 6 GHz can be combined together as a group and = provide >> >>>>>>> an abstraction to mac80211. >> >>>>>>> >> >>>>>>> Device group abstraction - when there are multiple devices that = are >> >>>>>>> connected by any means of communication interface between them, = then these >> >>>>>>> devices can be combined together as a single group using a group= id to form >> >>>>>>> a group abstraction. In ath12k driver, this abstraction would be= named as >> >>>>>>> ath12k_hw_group (ag). >> >>>>>>> >> >>>>>>> Please find below illustration of device group abstraction with = two >> >>>>>>> devices. >> >>>>>>> >> >>>>>>> Grouping of multiple devices (in future) >> >>>>>>> +---------------------------------------------------------------= ---------+ >> >>>>>>> | +-------------------------------------+ +-------------------+ = | >> >>>>>>> | | +-----------+ | | +-----------+ | | +-----------+ | | >> >>>>>>> | | | ar (2GHz) | | | | ar (5GHz) | | | | ar (6GHz) | | | >> >>>>>>> | | +-----------+ | | +-----------+ | | +-----------+ | | >> >>>>>>> | | ath12k_base (ab) | | ath12k_base (ab) | | >> >>>>>>> | | (Dual band device) | | | | >> >>>>>>> | +-------------------------------------+ +-------------------+ = | >> >>>>>>> | ath12k_hw_group (ag) based on group id | >> >>>>>>> +---------------------------------------------------------------= ---------+ >> >>>>>>> >> >>>>>>> Say for example, device 1 has two radios (2 GHz and 5 GHz band) = and >> >>>>>>> device 2 has one radio (6 GHz). >> >>>>>>> >> >>>>>>> In existing code - >> >>>>>>> device 1 will have two hardware abstractions hw1 (2 GHz) and hw2 >> >>>>>>> (5 GHz) will be registered separately to mac80211 as phy0 and ph= y1 >> >>>>>>> respectively. Similarly, device 2 will register its hw (6GHz) as >> >>>>>>> phy2 to mac80211. >> >>>>>>> >> >>>>>>> In future, with multi-link abstraction >> >>>>>>> >> >>>>>>> combination 1 - Different group id for device1 and device 2 >> >>>>>>> Device 1 will create a single hardware abstraction hw1 >> >>>>>>> (2 GHz and 5 GHz) and will be registered to mac80211 as >> >>>>>>> phy0. similarly, device 2 will register its hardware >> >>>>>>> (6 GHz) to mac80211 as phy1. >> >>>>>>> >> >>>>>>> combination 2 - Same group id for device1 and device 2 >> >>>>>>> Both device details are combined together as a group, say >> >>>>>>> group1, with single hardware abstraction of radios 2 GHz, >> >>>>>>> 5 GHz and 6 GHz band details and will be registered to >> >>>>>>> mac80211 as phy0. >> >>>>>>> >> >>>>>>> Add base infrastructure changes to add device grouping abstracti= on with >> >>>>>>> a single device. >> >>>>>>> >> >>>>>>> This patch series brings the base code changes with following or= der: >> >>>>>>> 1. Refactor existing code which would facilitate in introducing >> >>>>>>> device group abstraction. >> >>>>>>> 2. Create a device group abstraction during device probe. >> >>>>>>> 3. Start the device group only after QMI firmware ready event is >> >>>>>>> received for all the devices that are combined in the group. >> >>>>>>> 4. Move the hardware abstractions (ath12k_hw - ah) from device >> >>>>>>> (ath12k_base - ab) to device group abstraction (ag) as it would >> >>>>>>> ease in having different combinations of group abstraction that >> >>>>>>> can be registered to mac80211. >> >>>>>>> >> >>>>>>> v7: >> >>>>>>> - Added linux-wireless mailer to cc. >> >>>>>>> - Removed Acked-by tag from "[PATCH v6 8/8]" as it has minor cha= nge. >> >>>>>>> >> >>>>>>> v6: >> >>>>>>> - Addressed smatch error seen on "[PATCH v5 8/8] wifi: ath12k: m= ove >> >>>>>>> ath12k_hw from per soc to group" >> >>>>>>> - Rebased to ToT >> >>>>>>> v5: >> >>>>>>> - on "[PATCH 8/8] wifi: ath12k: move ath12k_hw from per soc to >> >>>>>>> group", refactor the ath12k_mac_hw_allocate() api based on ag ra= ther >> >>>>>>> than ab and update hardware abstraction array size in ath12k_hw_= group >> >>>>>>> as ATH12K_GROUP_MAX_RADIO. >> >>>>>>> - Rebased to ToT >> >>>>>>> v4: >> >>>>>>> - Modified the cover letter >> >>>>>>> v3: >> >>>>>>> - Removed depends-on tag of "wifi: ath12k: Refactor the hardware= recovery >> >>>>>>> procedures" as it is merged to ToT >> >>>>>>> - Addressed the deadlock warning seen during rmmod. >> >>>>>>> >> >>>>>>> v2: >> >>>>>>> - Rebased to ToT >> >>>>>>> >> >>>>>>> Karthikeyan Periyasamy (8): >> >>>>>>> wifi: ath12k: Refactor core start api >> >>>>>>> wifi: ath12k: Add helpers to get or set ath12k_hw >> >>>>>>> wifi: ath12k: Add ath12k_get_num_hw api >> >>>>>>> wifi: ath12k: Introduce QMI firmware ready flag >> >>>>>>> wifi: ath12k: move ATH12K_FLAG_REGISTERED flag set to mac_regist= er api >> >>>>>>> wifi: ath12k: Introduce device group abstraction >> >>>>>>> wifi: ath12k: refactor core start based on hardware group >> >>>>>>> wifi: ath12k: move ath12k_hw from per device to group >> >>>>>>> >> >>>>>>> drivers/net/wireless/ath/ath12k/core.c | 431 +++++++++++++++++++= ++---- >> >>>>>>> drivers/net/wireless/ath/ath12k/core.h | 87 ++++- >> >>>>>>> drivers/net/wireless/ath/ath12k/dp.c | 19 +- >> >>>>>>> drivers/net/wireless/ath/ath12k/dp.h | 2 +- >> >>>>>>> drivers/net/wireless/ath/ath12k/mac.c | 117 ++++--- >> >>>>>>> drivers/net/wireless/ath/ath12k/mac.h | 9 +- >> >>>>>>> drivers/net/wireless/ath/ath12k/pci.c | 2 + >> >>>>>>> drivers/net/wireless/ath/ath12k/qmi.c | 10 +- >> >>>>>>> 8 files changed, 544 insertions(+), 133 deletions(-) >> >>>>>>> >> >>>>>>> >> >>>>>>> base-commit: f8320064a28242448eeb9fece08abd865ea8a226 >> >>>>>> >> >>>>>> With this series I'm seeing a firmware crash upon resume from hib= ernation, but >> >>>>>> I'm not sure if it is the same intermittent crash I reported in a= nother thread >> >>>>>> where firmware is not correctly handling a low physical memory ad= dress. >> >>>>>> >> >>>>>> Baochen & Kalle, since this issue may be specific to my laptop, c= an you >> >>>>>> validate hibernation on your setups? >> >>>>> I can also see a firmware crash upon resume. I am using ath-202405= 281746 as code base. >> >>>> >> >>>> I bisected to: >> >>>> [PATCH v7 7/8] wifi: ath12k: refactor core start based on hardware = group >> >>>> >> >>>> >> >>> Thank you so much, Jeff. Identified the possible reason that is caus= ing >> >>> the firmware assert with hibernation scenario and will address it in >> >>> next version. >> >